(data stored in ACNUC7421 zone)

EMBL: CP001791.PE533

CP001791.PE533       Location/Qualifiers
FT   CDS_pept        587901..588362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0549"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   gme:Gmet_1881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98085"
FT                   /db_xref="GOA:D6XY12"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY12"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADH98085.1"
FT                   /translation="MALQRKFMVHSVDETRELAEKLAGKLTPDTVLTLEGDLGAGKTTF
FT                   TKALAKALGVEGTVNSPTFTIMKEYVGTMPFYHMDAYRIEDEGEDFGLDEYFNGGGVTV
FT                   IEWPSMIQSQLPSSRIDMTIIYRGPDTREIVLVGNGRDYIQVVKELSGK"
     atggctttgc agcggaaatt catggtgcac agtgtggatg aaacccggga actggcagaa        60
     aagcttgcgg gtaagcttac acctgatacg gttctgaccc ttgaaggaga cttgggggca       120
     ggtaaaacaa cgtttactaa agcgctggca aaggcgctgg gtgtcgaagg tacggtgaac       180
     agtccaactt ttacgatcat gaaagagtac gttggcacga tgccttttta tcacatggat       240
     gcctaccgga tcgaagacga gggtgaggat tttggcctcg atgagtattt taacggcggc       300
     ggagtgacgg tgattgagtg gccatcgatg attcagagtc agctcccttc ctcgagaatt       360
     gacatgacca ttatttacag aggtccggac acccgtgaga ttgttcttgt gggaaatggc       420
     agggactaca ttcaggttgt aaaggagtta agcggaaaat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page