(data stored in ACNUC7421 zone)

EMBL: CP001791.PE535

CP001791.PE535       Location/Qualifiers
FT   CDS_pept        589056..589526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0551"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: ppd:Ppro_2631 ribosomal-protein-alanine
FT                   acetyltransferase; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98087"
FT                   /db_xref="GOA:D6XY14"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY14"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADH98087.1"
FT                   /translation="MADQETEKAGVRIRFMDVTDLDGVLELENRTFSTPWSRDAFYNEI
FT                   VKNQFAYYTVAESAEGAIVGYCGLWVIIDDAHITNIAVDPEWRREGIGERMMSEAMAFA
FT                   KKRGAERLSLEVRVSNTAAQAMYRKYGLQDGGIRKQYYTDNQEDALVMWVRL"
     atggcggatc aggaaactga gaaggcgggc gtccgtatcc ggtttatgga tgtaacggat        60
     ctcgacggtg tccttgagct tgagaaccgc acgttttcaa caccatggag ccgggatgcg       120
     ttctataatg aaatcgtgaa gaatcagttt gcctattaca cggtggcaga gtccgcagaa       180
     ggtgccatcg tcggttattg cggcctctgg gtgatcattg atgatgccca tatcaccaac       240
     atcgccgtcg atccggagtg gcggcgggag ggaattggtg agcggatgat gagtgaagcg       300
     atggccttcg cgaaaaaacg cggcgccgag cggctttctc tcgaagtccg ggtatcgaat       360
     accgccgctc aggccatgta caggaaatac ggccttcagg acggcgggat ccgtaagcag       420
     tattatacgg ataatcagga agatgcatta gtaatgtggg tgaggttata a                471
//

If you have problems or comments...

PBIL Back to PBIL home page