(data stored in ACNUC7421 zone)

EMBL: CP001791.PE538

CP001791.PE538       Location/Qualifiers
FT   CDS_pept        594789..595277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0554"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="KEGG: hap:HAPS_0437 molybdenum cofactor biosynthesis
FT                   protein C; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein C; PFAM: molybdopterin cofactor biosynthesis MoaC
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98090"
FT                   /db_xref="GOA:D6XY17"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY17"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADH98090.1"
FT                   /translation="MESFTHFNEQGRAKMVDISDKEETVRTAVAKSSVLVNKQIYEGIQ
FT                   SGHMKKGDVLAVAQVAGVMAAKNTAQLIPMCHPLSLSGVDIAFDWKEEGSSHRLHIRVA
FT                   VKTKGSTGVEMEALTSASATALTVYDMCKAVDKGMVIGETYLEEKTGGKSGDFKRASE"
     atggagtcat ttacacactt taatgaacag ggccgggcga agatggtgga catttccgat        60
     aaagaggaaa cggtccgtac tgcagttgca aaatcaagtg tacttgtgaa caaacagatc       120
     tatgaaggca tccagtcggg ccacatgaaa aaaggagatg tcctggccgt tgcccaggtc       180
     gcaggtgtca tggcggcgaa gaatacggcg cagctgatcc ccatgtgtca tccgctgtca       240
     ctgagcggcg tggatatcgc ttttgactgg aaggaagaag gatcatcgca tcgcctacat       300
     atccgcgttg cagtaaaaac aaaaggcagt accggggttg aaatggaagc gttaacatcg       360
     gcgagtgcga ctgcgttgac ggtctatgac atgtgcaaag cggtggataa gggcatggtc       420
     atcggtgaga cgtatcttga agaaaagaca ggcgggaaga gtggcgattt taaacgggca       480
     agtgaatag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page