(data stored in ACNUC7421 zone)

EMBL: CP001791.PE541

CP001791.PE541       Location/Qualifiers
FT   CDS_pept        597552..598544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0557"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534; KEGG:
FT                   rle:pRL110111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98093"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY20"
FT                   /inference="protein motif:PFAM:PF04392"
FT                   /protein_id="ADH98093.1"
FT                   /translation="MRTVFVITGLMLLAAGLFWYTESLQADEPAHLGVLLTESSRLDKL
FT                   EGIENGLRDLGFHVEDDLVFHVYEEEEDTDALMAMAREMLEADYDLIAAFGGIEAQVLD
FT                   VAMEETGLSTPVVFVGMAAPLDTGLIESYERPGTMFTGVANHHLNLSAKRLELFTDALP
FT                   EMDEVIVLYNKEIDISNRSCDVTREAVETLGIEVVPFDVGTELDLTALADLAGENTGLL
FT                   TLPSFIIEGMTGELADFSRAHDLPVMGIYDDEVAEGFLMAYGSSFYDQGYQAARQISLI
FT                   LGGNEASTIPVELPDRLLFQVNRDTAAHIGVSLDRDVMRLADEVKGGGD"
     atgcgaaccg tgtttgtcat taccggctta atgcttctgg cagccggact gttttggtat        60
     acggaatccc tgcaggcgga tgagcctgct catcttggcg tgctcctgac ggaaagcagc       120
     cggctcgaca agcttgaggg gatcgaaaac gggctccgtg atctcgggtt tcacgtggaa       180
     gatgatctgg tgtttcatgt gtacgaagag gaagaagata ccgatgcgct tatggccatg       240
     gccagagaga tgcttgaagc ggactacgac ctgattgcag cctttggcgg gatcgaagcc       300
     caggtgcttg acgtggcgat ggaagaaacg ggcctgtcga caccggtcgt ctttgtcggt       360
     atggcggctc cccttgatac aggcctcatc gaaagctatg aacggccggg gacgatgttt       420
     accggcgtgg ccaatcatca cctgaatctg tcggcgaaac gccttgagct cttcaccgat       480
     gcactcccgg agatggatga ggtgattgtg ctttacaata aagagatcga tatcagtaac       540
     cgctcttgtg acgtcacccg ggaggcagtg gaaacccttg gcatcgaggt ggtgccgttt       600
     gacgtcggaa cggagcttga tctcaccgct ttagcggatc ttgcaggtga gaacacgggc       660
     cttttgacac tgccgagttt catcatcgaa ggcatgaccg gggagctcgc ggacttcagc       720
     agggcgcatg atcttcctgt gatggggatt tatgatgacg aagtggcgga aggctttctg       780
     atggcctatg gctcatcctt ttatgatcag ggctatcagg cagcgaggca gatcagtctg       840
     attcttggcg gaaatgaagc atcgacgatt cccgttgagc ttccggacag gctgttgttt       900
     caggtgaacc gggatacggc agcgcatatc ggggtttccc ttgaccggga tgtcatgcgt       960
     ctggccgatg aggtgaaggg aggcggagac tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page