(data stored in ACNUC7421 zone)

EMBL: CP001791.PE542

CP001791.PE542       Location/Qualifiers
FT   CDS_pept        598544..600625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0558"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: gur:Gura_3573 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98094"
FT                   /db_xref="GOA:D6XY21"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY21"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH98094.1"
FT                   /translation="MRKKMQSIRNKVLFFGLLMTIIPLALISVYYIQNMADYVGETGEE
FT                   MQKMRLEHLATDIRSEIRQVMDQLDVLASLERPAEMKGPFYEVLSSQDAIDTLVVIDRD
FT                   GVLLSQVARHTLNHADTGDTWPVQADSGVTPDAGEPVISDVLVNEYGQPYMQMIAETGT
FT                   DGLRIGATVQLQKLIGNVSSYQLDDEAVIYLEDPSNQVIAHQDYSKLWQPSTEETAQGI
FT                   EIRTEIDEVQWELVMEQPRREALSPVFDMMRRGGFTATVMILFGSVISVFAGLYFVKPI
FT                   ETLQQGMRRMKTGYWPEAMPVERQDEFGELTRAFNEMNETIQEKEQRLRQEKERLDIVV
FT                   NSMDAGLAVVRKDYSIAWMNPKLEGWIGERREVPCFQLFHDQDDACYACPLRDEVTYDK
FT                   MDEIMTRKDRSGAERIYRHRVFPLNYTLEQDEEALIVMEDITEEKQMEEKIIQTDKLSA
FT                   LGLMASSFAHEVNNPLASVQIYAEDLSDRLTEDEAELLESGDMAHYLQVIRKNIDRCKT
FT                   ITGNLLNFSRKENWEERDIRVRQVVEESLVLMNHSLNKQGVDVTVTEEEGLPAIRGDAL
FT                   KLSQVFVNFIQNAIDAMAGKTAPALSIRLYQEGQDLLVDVADNGSGIRPEDLDKLFDPF
FT                   FTSKPTGKGTGLGLSVCYGIIKQMNGVLEVESEPGEGAVFRVRLPVPQKETNPEHGEV"
     atgagaaaga agatgcagtc cattcgaaat aaggttctct tcttcggcct gctgatgacg        60
     atcattcccc ttgccctcat ttccgtttac tacattcaga atatggctga ctatgtggga       120
     gaaaccggag aagagatgca aaaaatgcgt cttgagcatc ttgcgacgga tatccgctct       180
     gagatccgtc aggtgatgga tcagctcgat gtcctcgcgt cgcttgagcg gcctgctgag       240
     atgaaggggc ctttttatga agtgctgagc agtcaggacg ccattgatac cctcgttgtg       300
     atcgaccggg acggggtcct tttgagtcag gtggccaggc atacgctgaa tcatgccgac       360
     acaggtgata cctggccggt ccaggcagac tcgggcgtta ccccggacgc aggtgaaccg       420
     gtgatatcgg atgtcctcgt gaacgagtat ggtcagccgt atatgcagat gattgcggaa       480
     accggaacgg atgggctcag gattggcgca acggttcagc ttcagaagct gatcgggaac       540
     gtctcctcct atcagctcga tgatgaagcg gtgatttatc ttgaggatcc gtccaatcag       600
     gtcattgccc atcaggatta ttccaagctg tggcagccga gcaccgagga gacggcgcaa       660
     ggtattgaaa tccggacgga gatcgacgaa gtgcagtggg agctcgtcat ggaacagccc       720
     cggcgcgaag cgctgtcccc ggtgtttgac atgatgcgca ggggcgggtt taccgcgacg       780
     gtgatgatcc tgttcggcag tgtcatcagc gtctttgccg ggctctattt cgtcaagccg       840
     attgaaaccc tccaacaggg catgcggcgg atgaagacgg gctactggcc ggaagcgatg       900
     ccggtggaga ggcaggacga gttcggtgag ctgacccggg ccttcaatga gatgaacgag       960
     accattcagg aaaaggaaca gcggctcaga caggaaaagg aacgcctcga tatcgtcgtg      1020
     aattcgatgg atgccgggct tgccgttgtc cgtaaagact attcgattgc gtggatgaac      1080
     ccgaagcttg aaggatggat cggcgagagg cgtgaggtcc cctgctttca gctctttcat      1140
     gatcaggatg atgcctgtta tgcgtgtccg ctccgtgacg aggtgacgta tgacaagatg      1200
     gatgaaatca tgacaagaaa ggaccgttca ggagcggagc ggatttaccg tcacagggtg      1260
     ttcccgctta attataccct cgaacaggac gaggaggccc tgatcgtcat ggaggacatt      1320
     acggaagaga agcagatgga agagaagatc atccagacgg ataagctgtc ggctcttggc      1380
     ctgatggcgt cgtcctttgc ccatgaagtc aataatccgc tcgcttccgt gcagatctat      1440
     gcggaagatt tgagtgaccg cctgacagaa gatgaggcag aacttcttga aagtggcgac      1500
     atggcccatt acctgcaggt catccgcaag aatattgacc gatgcaagac gatcacgggc      1560
     aatcttctga acttctcccg taaagagaac tgggaagaac gggatatccg cgtcagacag      1620
     gtcgtcgagg agagccttgt cctgatgaat cattccctga acaaacaggg tgtcgacgtc      1680
     acggtcacag aagaagaagg actgcctgcg attcgcgggg acgcgttaaa gctcagtcag      1740
     gtgttcgtga acttcattca gaacgccatt gatgccatgg ccggcaaaac ggcccccgct      1800
     ctgtcgatcc gtctgtatca ggaggggcaa gatctcctgg tggacgtggc ggataacggc      1860
     agcgggatcc ggccggaaga tctcgataaa ttgtttgatc ctttcttcac atcgaagccg      1920
     acgggaaaag gcacgggtct tggcctgtcg gtctgttacg ggattattaa acagatgaac      1980
     ggcgtacttg aagtggagag tgaaccgggg gaaggagcgg tattccgcgt ccggctccct      2040
     gttcctcaga aagaaacgaa tcctgaacat ggggaggtgt aa                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page