(data stored in ACNUC7421 zone)

EMBL: CP001791.PE545

CP001791.PE545       Location/Qualifiers
FT   CDS_pept        602429..603289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0561"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dma:DMR_37360 molybdopterin oxidoreductase
FT                   iron-sulfur binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98097"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR031604"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY24"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADH98097.1"
FT                   /translation="MAMKHDLLINKSLLSGRDILSKSAYSTDLGLNMAEDARRLSDGLM
FT                   SEEEFVNKYQESVGKEFNQKLEVRAAAGQDHANVKWGMVIDLRKCVGCETCTVSCKAEN
FT                   RTPPGVSYNQVFVEEEGTFPNVSRTNIARPCMHCDKPPCASVCPVRATYKADNGIVVQD
FT                   NDRCIGCRYCMVACPYGARSFDFGEEYEEILDANMIQAPEHGMERGERGNGEAPIGTVR
FT                   KCNFCFHRLERGEEPACVETCIGDARYFGDLNNPESTVSKLAASSRAFRLKEEYGTEPR
FT                   VYYLR"
     atggcaatga aacacgatct gttgattaac aaatcattac tcagtggaag agacatttta        60
     agcaaatccg catacagcac cgatcttggc ctgaacatgg ctgaagatgc gaggcgtctg       120
     tcggacggtc tgatgagcga ggaagagttt gtaaacaagt atcaggaatc cgtcggtaag       180
     gagttcaatc agaagctcga agtcagggct gcggcagggc aggaccatgc caatgtgaaa       240
     tggggcatgg tgatcgacct cagaaaatgc gtcggctgtg aaacctgtac cgtatcgtgt       300
     aaagcggaaa accggacgcc gcctggtgta tcgtacaatc aggtcttcgt tgaggaagaa       360
     gggacgttcc cgaacgtctc aagaaccaat attgctagac cgtgcatgca ctgtgacaag       420
     ccgccttgtg cgtctgtctg tccggtacgt gccacataca aagcggataa cggcatcgtc       480
     gtccaggata atgaccgctg catcggctgc cgctattgca tggttgcctg tccatacgga       540
     gcgagaagct ttgactttgg tgaagagtat gaagagattc tcgatgcgaa catgattcag       600
     gcgccggaac acggcatgga acgcggtgag cgcggaaacg gggaagcgcc gatcggcacg       660
     gtccgtaaat gcaatttctg tttccaccgt ttggaacgtg gcgaagagcc ggcctgtgtc       720
     gaaacgtgta tcggtgatgc ccgttatttc ggggacttaa acaatccgga atcaacggta       780
     tcgaaactcg ctgcaagcag ccgggcattc agactgaaag aagagtacgg cacggaaccg       840
     cgtgtctact acttacgata a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page