(data stored in ACNUC7421 zone)

EMBL: CP001791.PE546

CP001791.PE546       Location/Qualifiers
FT   CDS_pept        603304..604590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0562"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   afw:Anae109_3085 polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98098"
FT                   /db_xref="GOA:D6XY25"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY25"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ADH98098.1"
FT                   /translation="MSELTQTTAEHQQDLDPGIVAKRFKLWMASLFIALIAGGGAILYR
FT                   LIEGLSVTNLTTFVPWGAWVAFYIFFVGLSAGAFLLSTLIFVFGMEQYERVGRYALFTA
FT                   LVSMVVALTFIALDLGRIDRAFNAMTYWNALSILSYEVRFYLIYMALLAVELWFAMRID
FT                   LVRVAKSDDGIKGKVANFLRLGSDDESDISKKKDHRWMKILGIIGIPIAIIGVHGGTGT
FT                   LFAAVAAQPYWNSPLFPVIFVVSALVSGTALLIAMYVIQRKASGKSVDFGMVKSLSLLM
FT                   IGFLIIDLGLEFYEFLVAGLTMKPEKMAILNVMFTGPMSWSFWGVQLFIGAVIPIFIVF
FT                   SKRFNQSIGWLTAAAIMVVIGIIGVRFNIVVPTQIVQSMKALPEAFYFPNWVEWLSSIG
FT                   VVAMGLIIYSIGAKLLPLELNEDEVKSHE"
     atgagtgaat tgacacagac aaccgcagaa catcagcaag acctcgatcc ggggatcgta        60
     gcgaagcgtt ttaaactttg gatggcttcc cttttcattg cactgattgc agggggcggc       120
     gcgattctct atcgcctgat tgaagggctc agcgtgacaa acctgacaac cttcgttccc       180
     tggggcgcat gggtcgcctt ttatatcttc tttgtcggct taagtgcagg ggcgtttctg       240
     ctgtccacgc tgatttttgt attcggcatg gaacagtacg aacgggtcgg acgctatgcc       300
     ctgttcacgg ccctcgtctc gatggtggtg gccctgacct ttatcgctct tgatcttggg       360
     cgcatcgacc gggcgtttaa cgcgatgacc tactggaacg ccctcagtat tctctcttat       420
     gaagtccgct tttatttaat ctatatggcc cttctcgccg tggaactgtg gttcgccatg       480
     cgaatcgacc tcgtcagggt tgccaaatcg gacgacggaa tcaaaggcaa agtggccaac       540
     ttcctgcgtc tcggcagtga tgacgaatcg gatatctcaa agaagaaaga ccaccgctgg       600
     atgaagattc tcgggatcat cgggattccg attgcgatca tcggcgttca cggcggaacc       660
     ggcaccctgt tcgcagcggt tgccgcgcag ccttactgga actcgccgct cttcccggtc       720
     atctttgtcg tctcggcact ggtatccgga acagcgctgt tgattgccat gtatgtcatt       780
     cagcgaaaag caagcggcaa atccgtggac ttcggcatgg tgaagagcct gtcgcttttg       840
     atgatcggat ttctgatcat tgacctcggt cttgaatttt acgagtttct tgtcgcaggt       900
     cttacgatga agccggagaa gatggcgatt ttaaacgtca tgttcaccgg gccgatgtcc       960
     tggtcgttct ggggcgtaca gctctttatc ggagccgtta tcccgatctt catcgtattc      1020
     agtaaacggt tcaatcagtc gattggctgg ctgaccgcag cggcgatcat ggtcgtcatc      1080
     gggatcatcg gtgtacggtt taacatcgtc gttccgacgc agattgtcca gtccatgaag      1140
     gcattgccgg aagcgttcta cttcccgaac tgggtggagt ggctcagctc catcggggtt      1200
     gtggcgatgg gtctgatcat ctactccatc ggcgcaaagc tcttgcccct tgaattaaac      1260
     gaagatgagg tgaaatcaca tgagtaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page