(data stored in ACNUC7421 zone)

EMBL: CP001791.PE552

CP001791.PE552       Location/Qualifiers
FT   CDS_pept        609959..611593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0568"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: pca:Pcar_2770 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98104"
FT                   /db_xref="GOA:D6XY31"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY31"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADH98104.1"
FT                   /translation="MAKDIKFSEDARRAMLRGVDRLADTVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDNFENMGAQLVSEVASKTNDIAGDGTTTATVLAQSMIAEGLK
FT                   NVTSGANPMVIRKGIEKATQAAVDELRAISKPIEGRESISQVAAISSADDEVGELIAEA
FT                   MERVGNDGVITVEESKGFATELEVVEGMQFDRGYASPYMVTDSDKMEAVLEDPYILITD
FT                   KKIGNIQEVLPVLEQVVQQSRPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDVATLTGGEVITEDLGLDLKSASITQLGRASKVVVTKDNTTIVDGNGDAAEI
FT                   ANRVNQIKAQLEETTSEFDKEKLQERLAKLAGGVAVVKVGAATETEMKEKKLRIEDALN
FT                   STRAAVEEGIVAGGGTALINVLNAVKAVEADGDEATGVNIVLRALEEPLRQIAHNAGLE
FT                   GSIIVERLKGEEVGVGFNAATGEYVNMVEAGIVDPTKVTRSALQNAASVSAMFLTTEAV
FT                   IADFPEENSGGGGMPDMGGMGGMGGMM"
     atggctaaag acattaaatt cagtgaagac gctcgtcgcg cgatgctgcg cggtgtggat        60
     cgtcttgcag atacggtaaa agtaaccctc ggaccgaaag gacgtaacgt tgtccttgag       120
     aagaagttcg gctctccgtt aatcacaaac gatggtgtga cgattgcgaa agaaattgaa       180
     cttgaagaca atttcgagaa catgggtgct cagctcgttt ccgaagtcgc aagcaagacg       240
     aacgacattg ccggtgacgg taccacaacg gcaacggttc tcgcgcagtc catgatcgca       300
     gaaggcctga agaacgtcac atccggggcc aacccgatgg tgatccgtaa ggggattgaa       360
     aaagcgactc aggctgcggt ggatgagctg cgcgccattt ccaagccgat cgaaggcaga       420
     gagtcgatct cccaggttgc ggcgatctct tcagcggatg atgaagtcgg tgaactgatt       480
     gcagaggcga tggagcgcgt cggtaacgac ggtgtcatca cagtggaaga atcgaaaggg       540
     ttcgcgacag agcttgaagt cgtggaaggg atgcagttcg accgtggata cgcgtctcct       600
     tacatggtga cggattctga caagatggaa gcggttcttg aagatccgta tatcctgatc       660
     actgataaga aaatcggcaa catccaggaa gtattgccgg ttcttgagca ggttgttcag       720
     cagtcccgtc caatcctgat cattgccgaa gacgtggaag gcgaagccct cgcgacactc       780
     gtcgtcaaca agctccgcgg cacattcaac gctgttgccg tgaaggcacc aggctttggt       840
     gaccgtcgta aagcgatgct tgaagacgtt gcaacactca ctggtggtga agtgatcacg       900
     gaggacctcg gtcttgatct caaatctgcg agcattacac agctcggccg tgcgtccaag       960
     gtcgttgtta caaaagacaa cacgacgatc gttgacggca acggtgacgc agcggaaatt      1020
     gcaaaccgtg tcaaccagat caaagcacag ctcgaagaga ccacttccga gttcgataaa      1080
     gagaagcttc aggagcgtct tgccaagctt gccggcggtg tagccgttgt caaagtcggt      1140
     gcggccactg aaacggaaat gaaagagaaa aagctccgca ttgaagacgc actgaactcc      1200
     acgcgtgcag cggtggaaga aggtattgta gccggcggtg gtacagcgct gatcaacgta      1260
     ttgaacgcag tgaaggctgt agaagcggac ggtgacgaag caacgggcgt gaacattgtg      1320
     ctccgtgccc ttgaagaacc gctccgtcag attgcccaca atgccggact tgaagggtcc      1380
     atcatcgtgg agcgcctgaa aggtgaagaa gtcggtgtcg gctttaacgc agcgaccggt      1440
     gaatatgtca atatggttga agcggggatc gtcgacccga cgaaggtcac acgctcagcc      1500
     ctccaaaacg cagccagcgt atctgccatg ttccttacga cagaagctgt tatcgcagac      1560
     ttccctgaag agaacagcgg cggtggcggc atgccggaca tgggtggcat gggcggtatg      1620
     ggcggcatga tgtaa                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page