(data stored in ACNUC7421 zone)

EMBL: CP001791.PE554

CP001791.PE554       Location/Qualifiers
FT   CDS_pept        complement(613690..614721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0570"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98106"
FT                   /db_xref="GOA:D6XY33"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY33"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ADH98106.1"
FT                   /translation="MKENFWHDLPKPFFILAPMEAVTDVVFRHVVSEAAAPDVFFTEFA
FT                   NSDSFCHPKGRESLKGRLMFTEDEQPIVAHIWGDKPEHFRTMSVAMAEMGYKGIDINMG
FT                   CPVHNVAGDGKGAGLIKRPDVAAELIEAAKAGGLPVSVKTRIGFSKIDEWQNWLRHILE
FT                   QDIVNLSIHLRTKKEMSDVPAHWELIPDIKALRDEVAPNTLLTINGDIDDRQTGLELAE
FT                   KYGVDGIMIGRGIFKNPFAFETEPKEHTSEELLGLLRLQLDLHDKYSKDLENRPFTPLQ
FT                   RFFKIYVRSFPKAGELRKKLMETKTTDEVRAILDTFEKEKQAEEKAEAEALCQTASTDH
FT                   VHS"
     atgaaagaaa acttctggca tgacctgcca aaaccgtttt ttatattggc gccgatggag        60
     gccgtgacag acgtggtgtt ccgccacgtc gtcagtgaag ctgcggcacc ggacgtgttc       120
     tttaccgaat tcgccaattc ggacagcttc tgtcacccaa aaggcagaga gagcctgaag       180
     gggcgtctca tgttcacgga agacgagcag ccgatcgttg cgcacatttg gggtgataag       240
     cctgagcact tccggacgat gagtgtcgcc atggctgaga tgggctacaa aggcatcgac       300
     atcaacatgg gctgtcccgt gcataacgtg gccggtgacg gcaaaggggc cggcctgatc       360
     aagcgtcctg acgtcgccgc cgaactgatt gaagccgcca aagcgggcgg ccttccggta       420
     agtgtcaaaa cccggatcgg cttttcaaag attgatgaat ggcaaaattg gctcagacat       480
     atcctcgagc aggatatcgt caatctgtcc attcacctgc gaacaaaaaa agaaatgagc       540
     gacgtccctg ctcactggga gctaatccct gacatcaagg ccctccggga cgaggtggca       600
     ccgaacaccc tcctcacaat taacggcgac atcgatgacc ggcagaccgg tctcgaactc       660
     gcggagaaat acggtgtgga cgggattatg atcggacggg gcatcttcaa gaacccgttc       720
     gcttttgaaa ccgaaccgaa agagcatacg agcgaagagc tcctcggact tctgcgtctt       780
     cagctcgatc ttcatgacaa atacagcaaa gatctcgaaa accgaccgtt tactcctctg       840
     cagcgcttct tcaagatcta cgtccgcagc tttccaaagg ccggcgagct ccgcaagaaa       900
     ctgatggaaa cgaaaacaac cgatgaagtc agggcgattc ttgatacctt cgaaaaagag       960
     aaacaggcgg aagaaaaagc cgaggcagaa gccctttgtc agacggcatc cactgaccac      1020
     gtgcacagct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page