(data stored in ACNUC7421 zone)

EMBL: CP001791.PE557

CP001791.PE557       Location/Qualifiers
FT   CDS_pept        complement(617704..618879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0573"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: hypothetical protein
FT                   LOC100240917"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98109"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY36"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADH98109.1"
FT                   /translation="MTTDHYGAFIDESLTVEPQKGGILHRKTFAVKDVFHIEGHRNTAG
FT                   NPHWLQSHAPAKATAPALVHLLQAGATLKGTTVTDEMMYSLHGENVHYGTPVNPFDKSL
FT                   IPGGSSSGSAVATGAGLRDFAIGTDTGGSVRIPASYCGLFGFRPSHGKVSLEGVIPLAD
FT                   SFDTVGWFTRNAALLEDVGEVLIGDSMPDAPDFKRAVIARDAFSLLTDTQHNALMSAVR
FT                   SCSSKVKSHEEQRITNDDLGDWVDIFRVIQGYEIWLNHGEWVKAHEPDFGPGIRERFHM
FT                   AEQIKEADVAEARRRQLMIQDATADIMQPDTLMIIPTIAGEPPAVGLPPEEVDKIRQRT
FT                   MKLTAIAGLNGLPQVTIPVKRGGGLPPLAISILAPKGRDRDLLSFVTSLCD"
     atgacaaccg atcattacgg cgcatttatt gatgaatcac tgaccgtgga accgcagaaa        60
     ggcgggattc ttcacaggaa gaccttcgcc gtcaaggatg tctttcatat agaggggcac       120
     cgcaacaccg ccggcaaccc ccattggctc caatcccatg cgcctgccaa agcgacggca       180
     ccggcactgg ttcatctctt gcaagcaggt gccacactca agggaacgac cgtgaccgat       240
     gaaatgatgt acagccttca cggggaaaat gtgcattacg gaacgcctgt caatcctttc       300
     gataaatccc tcatccccgg cgggtcctcc agcggttcag ccgttgccac cggtgcagga       360
     ctgagggatt tcgccatcgg caccgacaca ggcggctccg tgcgtattcc cgcttcgtac       420
     tgcggcctgt tcggctttcg tccgagtcac ggaaaagtca gcctcgaagg cgtcattcct       480
     ttggcggatt cctttgatac agtcggctgg tttacccgga atgccgctct ccttgaagat       540
     gtcggtgaag tcctcattgg cgacagcatg cctgatgcac cggatttcaa acgtgcggtc       600
     atcgccaggg atgccttcag cctgttgaca gacacgcagc acaatgcgct catgtcggca       660
     gtcagaagct gttcaagcaa ggtgaagtca catgaagaac agcgcatcac caacgatgat       720
     ctcggtgatt gggtggacat tttccgggtg attcagggct atgaaatctg gctgaatcat       780
     ggggaatggg tcaaagccca cgaaccggat ttcggacccg ggatccgcga acggttccat       840
     atggccgaac agatcaaaga agccgatgtc gccgaggcaa gacgcagaca gctcatgatt       900
     caggatgcca cggctgatat tatgcagccg gataccctca tgatcatccc gacgatcgcc       960
     ggtgaacctc ccgctgtcgg actgcctccg gaggaagtgg acaagattcg ccagcgcacg      1020
     atgaagctca ccgccatcgc gggccttaac gggctccctc aggtcaccat ccccgtcaaa      1080
     cggggcggcg gactgcctcc gttggccatt tccatcctcg caccgaaggg gcgtgaccgg      1140
     gatctgctca gttttgtcac gtcgctttgt gactga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page