(data stored in ACNUC7421 zone)

EMBL: CP001791.PE559

CP001791.PE559       Location/Qualifiers
FT   CDS_pept        620529..621377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0575"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   avi:Avi_5433 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98111"
FT                   /db_xref="GOA:D6XY38"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY38"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADH98111.1"
FT                   /translation="MDQLYIHTPDTLSEAWALKTKDPTDSLWLSGTTWLRTQWEAGQLK
FT                   TQKQWIRLDGIPELTSGIRRDESTLRIAALTTFGEISRCGDTAAFAPLLKQAIHEIAAP
FT                   SIREQATIGGNVATGSGDSIPALLASGASVLVYTEGRDEEWLLEDWLAAGMSGIIVDIA
FT                   IPVHKESEDLNVYVKTGRREAFIPSAATFAIKGSWDSDTKTFRTCRAAAGGGTMVPVRL
FT                   KRLERFLKETPLTSNAVFKKMADEVKKDYRPEDDPFLSGAYKQQIVCNQIIQNIHSNIR
FT                   R"
     atggatcagc tttatattca taccccggac acgctgtcgg aagcctgggc gttgaaaaca        60
     aaagatccga cggacagcct ttggctatcc ggaaccacgt ggctcagaac gcagtgggaa       120
     gcaggacagc tgaagacaca gaaacagtgg atccgtcttg acggtattcc ggagctaacc       180
     tctgggatcc gtcgtgatga atcaactctt cgcattgcgg cattgaccac tttcggtgag       240
     atcagccggt gcggggatac ggccgctttt gcgccgctgt taaaacaggc gatccatgag       300
     attgcggcgc cgtcgatccg tgaacaggcg accatcggtg gtaacgtggc gacaggatcc       360
     ggtgacagca ttcccgcgct gcttgcaagc ggcgcatcgg tccttgttta caccgagggg       420
     cgtgacgaag agtggctgct tgaagactgg ctcgccgccg gcatgtcagg catcattgtg       480
     gatatcgcca tccccgttca taaggaaagc gaagatctga atgtgtatgt caaaacaggg       540
     cgccgtgaag catttattcc atcggctgcg acgtttgcca ttaaaggctc ctgggacagc       600
     gacacaaaga cattccggac ttgccgggct gcggccgggg gaggaacgat ggtccctgtg       660
     agactgaagc gtcttgagcg gttcctgaag gagacgccac tgacgtcgaa tgcggtcttc       720
     aaaaaaatgg cggacgaagt gaagaaggac taccgcccgg aggatgaccc cttcttgagc       780
     ggtgcctata agcagcagat tgtctgcaat caaataattc agaatattca ttctaatatc       840
     aggaggtga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page