(data stored in ACNUC7421 zone)

EMBL: CP001791.PE561

CP001791.PE561       Location/Qualifiers
FT   CDS_pept        623671..624204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0577"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: glo:Glov_2414 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98113"
FT                   /db_xref="GOA:D6XY40"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY40"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADH98113.1"
FT                   /translation="MNPLMKAYQEDDATRMTIRFTLNGQTKVIHVPPERRLVDLIRTDF
FT                   NLTGTKISCEVGRCGACMVIVDGKPMNSCLLMAYQIEGRSIDTIEGLTVSDSRTRDLQE
FT                   LFLEEGALQCGYCTPGMIVSLTGCLNGDGDAGFEDLKEALSGNLCRCTGYGGIHRVISR
FT                   LTENQDEKGREADV"
     atgaacccgc tgatgaaggc ttatcaggaa gatgatgcaa cacgcatgac catccggttt        60
     accctgaacg ggcaaacaaa ggtcatacac gtgccgccgg agcgacggct cgtcgatctg       120
     atccggacgg atttcaatct gacaggaacg aaaatttcct gtgaagtggg acgctgcggt       180
     gcctgtatgg tcatcgtcga cgggaaaccg atgaacagct gcctgctcat ggcctatcag       240
     attgaaggcc gttccatcga cacgattgaa ggactgacgg tatcagacag ccggacccgg       300
     gatttgcagg agctgtttct cgaagaagga gccttgcagt gcggatactg tacgccggga       360
     atgattgtat cattgacagg ctgcctcaat ggagatgggg atgccggctt tgaagatctt       420
     aaagaagcgt tgtccggcaa cctgtgccgt tgcaccggct acggcgggat tcaccgtgtg       480
     atcagccggc tgacagagaa tcaggatgag aaaggacgtg aggcggatgt ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page