(data stored in ACNUC7421 zone)

EMBL: CP001791.PE563

CP001791.PE563       Location/Qualifiers
FT   CDS_pept        625242..625877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0579"
FT                   /product="molybdenum hydroxylase accessory protein, YgfJ
FT                   family"
FT                   /note="KEGG: geo:Geob_0102 molybdenum hydroxylase accessory
FT                   protein, YgfJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98115"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY42"
FT                   /inference="similar to AA sequence:KEGG:Geob_0102"
FT                   /protein_id="ADH98115.1"
FT                   /translation="MFSTTVHAIILAAGQSTRMGEPKQTLSIEGHTLIDHAVLKVSKLP
FT                   VERIVIITGEHHEALKDAVTIEDSRIHFIHNPDYVSGQASSLKKGLCYAQSRGAHALVM
FT                   LADQPLIAAETFKAVLDEGLSMKASRKPYSVRPMFHGRQGHPVFFGRPYLLNLMCLKMP
FT                   GDEGGKRLRNQLVNLHTAVDDPYISFDVDTPADLKKARERMQKPLPVQ"
     atgttttcaa caacggttca tgcgatcata cttgcagcgg gtcagtcaac gcggatggga        60
     gagccgaaac agacgctctc cattgaaggt catacgctga ttgatcacgc tgttctgaag       120
     gtgtcaaaac tgcctgtgga gcggattgtg atcattaccg gtgaacatca tgaggcgctg       180
     aaagatgccg tcaccattga ggattcacgg attcacttca ttcataatcc cgactatgtc       240
     tccggacagg cctcttctct taaaaaagga ctctgttacg cacagtcgcg gggcgcacat       300
     gcactcgtga tgcttgccga tcagcctctg attgcggctg agacgttcaa agcggtcctg       360
     gatgaaggac tgtccatgaa agcaagccgg aagccgtatt cggtgaggcc gatgtttcac       420
     ggacgtcagg gtcatccggt ctttttcggc agaccgtatc tgctcaacct gatgtgcttg       480
     aagatgcccg gagacgaagg tggcaaacgg cttcgaaacc agctcgtcaa tctccacacg       540
     gcggtggatg atccttacat ctcgtttgat gtggatacgc cggcggatct gaagaaagca       600
     cgggaacgga tgcaaaagcc gcttcccgtt caataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page