(data stored in ACNUC7421 zone)

EMBL: CP001791.PE564

CP001791.PE564       Location/Qualifiers
FT   CDS_pept        625980..627338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0580"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   mxa:MXAN_5705 N-ethylammeline chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98116"
FT                   /db_xref="GOA:D6XY43"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY43"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADH98116.1"
FT                   /translation="MGSIVLKNAEIITMNAGREAVFGDVLIEGDTITAVGKNLPCPDDA
FT                   EVIDATGRVVIPGFIQTHIHLCQTLFRGRGDDLELMDWLKGRIWPLEAAHDEESIYYSA
FT                   LLGTGELIQSGTTSIVDMETVHHTDSAFEGMAQSGIRAISGKVMMDKGDEVPLPLQEKT
FT                   AESLQASQDLYEKWHGYDNGRLQYAYSPRFVVSCTEELLRETARLSEMQNVRVHTHAAE
FT                   NRGEIAIVERETGMRNVEYLHKLGLANERLMLAHCIWLSDNEKKIIRDNRVNVTHCPGS
FT                   NLKLASGKAEIPQLLDAHVCVSLGADGAPCNNNLDMFNEMRLAALIHKPEHGPTAMDAK
FT                   TVFEMATIGGAKAMGLDDKIGSIEPGKKADLAILNLNDLHMYPSYGVDTLSRIVYSATR
FT                   ADVETTIINGKPVMKNRMLHTMDKETLMQEANTSIKRLIKRSGIPGQTKAVSG"
     atgggatcca tcgtactgaa gaacgcagag atcatcacaa tgaacgccgg acgggaagcc        60
     gtcttcggtg atgtattgat tgaaggggat acgatcaccg cggtcgggaa aaacctgccg       120
     tgcccggacg acgcagaggt cattgacgcc accggccggg tcgtgatccc cggttttatt       180
     cagacccata ttcacttatg ccagacgctc tttcgcggac ggggggatga tttggaactg       240
     atggactggc tcaagggtcg catctggccc ctggaggctg cccatgatga agaatccatc       300
     tactactccg ctctactggg caccggcgaa ctgatccaaa gcgggacgac gtccatcgtc       360
     gatatggaga cggttcacca taccgattca gcgtttgaag gcatggcgca gtccggaatc       420
     cgcgccatct caggcaaggt catgatggac aaaggcgacg aagtccctct tcctctgcag       480
     gagaagacgg cggagtccct gcaggccagt caggatctgt atgaaaaatg gcacggctat       540
     gacaacgggc gccttcagta tgcgtattcg ccgaggttcg tcgtgtcctg cacggaggag       600
     ctcttaagag agacggcgag gctgtcggag atgcaaaacg tccgggtcca tacccacgcc       660
     gcggaaaaca gaggcgaaat cgccatcgtg gagcgcgaga caggcatgcg taatgtggag       720
     tatctccaca agctcggtct tgccaatgag cggctcatgc tcgctcactg tatctggctc       780
     agtgacaatg agaagaagat catacgtgat aaccgggtga acgtcaccca ctgtccgggc       840
     tcgaatctga agctcgcttc cgggaaagcg gagatccccc agcttcttga tgcccatgtc       900
     tgcgtcagtc tcggagcgga cggggccccc tgcaacaaca atcttgacat gtttaatgag       960
     atgcgcctcg ctgccctgat tcacaagccc gagcacgggc cgacggcgat ggatgccaaa      1020
     accgtcttcg aaatggcgac gatcggcggg gcaaaggcga tggggctcga cgacaaaatc      1080
     ggaagcattg aacccgggaa gaaggcggat ttggctattt tgaacctgaa tgatctccat      1140
     atgtatccgt cttacggtgt cgacacactg tcgagaattg tttattccgc gacgagagcc      1200
     gatgtcgaga cgacgattat caatgggaaa ccggtcatga agaaccggat gcttcacaca      1260
     atggataaag aaaccctcat gcaggaagcg aatacatcga ttaaacggct gatcaaaaga      1320
     agcgggattc caggacagac caaagccgtc agtggctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page