(data stored in ACNUC7421 zone)

EMBL: CP001791.PE566

CP001791.PE566       Location/Qualifiers
FT   CDS_pept        627892..628848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0582"
FT                   /product="urate oxidase"
FT                   /EC_number="1.7.3.3"
FT                   /note="TIGRFAM: urate oxidase; KEGG: hypothetical protein;
FT                   K00365 urate oxidase; PFAM: Uricase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98118"
FT                   /db_xref="GOA:D6XY45"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY45"
FT                   /inference="protein motif:TFAM:TIGR03383"
FT                   /protein_id="ADH98118.1"
FT                   /translation="MSERTMLYGKGDVFVYRTYATPLKGVRQIPESNFTGRSNTIFGMD
FT                   IQVSLAGEAFLTSFTEGDNAKVVATDSMKNFILHHAGEYEGTTMEGFLAYVSACFLDTY
FT                   DHISEVEMSGRQFPFEAVEVGSPAGVVPSETVFREGMLEKPGTRISVGRDENGEAQIGS
FT                   LESAVHDLHLIKVKGSSFAGFIRDEYTTLPETKDRPLFIYLNISWTYKETEHALGATPE
FT                   QYVAAEQVKHIAQTLFHQEDSPSIQKLIYDIGIRVLERFPQLETVSFESNNRTWETVRD
FT                   EIPASGEGKVFTDPRPPFGFQKFTVLQEDVKREEALR"
     atgtctgaac gaacgatgtt atacggcaaa ggggacgttt ttgtctaccg cacatacgct        60
     acaccgctta aaggggtcag acagatccct gaatcaaatt tcacaggaag atcaaatacg       120
     attttcggta tggatatcca ggtatctctc gccggtgaag ccttcctgac gtctttcact       180
     gaaggggaca atgccaaagt ggtggcgacg gattcgatga agaacttcat tctccatcac       240
     gccggagaat atgaagggac gacgatggaa ggtttcctcg cctatgtgag tgcctgcttc       300
     cttgatacgt atgaccatat ttcagaggtg gagatgtcag gaagacagtt tccgttcgaa       360
     gcggtcgaag tcggttcacc agccggcgtc gtgccgagtg agacggtgtt tcgggaaggg       420
     atgcttgaaa aaccggggac ccgtatcagc gttggacgtg atgagaacgg cgaagcacag       480
     atcggttctc tcgaaagcgc tgtgcatgat ctgcatctga ttaaagtgaa aggaagcagc       540
     tttgcgggct ttatccgcga tgaatataca accctgccgg aaacgaagga ccgtccgctc       600
     tttatttatc tgaacatcag ctggacgtac aaagagacgg agcatgccct cggagcgacc       660
     cccgagcagt acgtggcagc agaacaggtc aagcacatcg cccagaccct ctttcatcag       720
     gaagattcgc cgtccatcca gaagctgatc tatgacatcg gtattcgcgt ccttgagcgt       780
     ttcccccagc ttgaaacggt ttcctttgaa tcgaataacc gtacgtggga aacggtacgc       840
     gacgagattc cggcatccgg tgaaggcaag gtcttcacgg atccgaggcc gccgttcggc       900
     tttcagaaat tcacggtcct tcaggaggat gtgaagcgtg aggaggccct ccgctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page