(data stored in ACNUC7421 zone)

EMBL: CP001791.PE568

CP001791.PE568       Location/Qualifiers
FT   CDS_pept        629212..630471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0584"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   KEGG: mes:Meso_2546 allantoate amidohydrolase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98120"
FT                   /db_xref="GOA:D6XY47"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY47"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADH98120.1"
FT                   /translation="MQTMTGIDQLRLWRTLMDLRQIGAGATEADGITRLAFSPPELEAK
FT                   AYIRVLMEECGLDVYTDAVGNVFGVYQGREPDLPVIMTGSHVDSVIRGGAFDGTLGVLG
FT                   AIEAVRTMKEAGIRPRRTIEIVSFSDEEGTRFGAGYMGSKALAGKLDDRFLTLTDQEGE
FT                   SYETVLTKAGYEPSAYPKAKRDSREIGAFLEMHIEQGRVLEEADIAAGIVTTIQGPLWL
FT                   QVTIEGAADHAGATPMAIRKDASLAMAEAMLAVEEAAVTHGGVGTVGSLKVKPGGINII
FT                   PGEVVFTVDMRHGDTTLRDRMLTDIEASFSAIAGKRGVSFKTLVTKKEPPATCSEDIRA
FT                   SIHQAANTCGIPVKDMPCGAGHDALIMSTVTRMGMILVRSQDGISHNPQEWTSQEDCAK
FT                   GTELLMRTLHSLAEERGDEA"
     atgcagacaa tgacagggat cgatcagctg cggctgtggc ggacgcttat ggacctccgc        60
     caaatcggag caggtgcaac cgaagcggac gggattacga ggcttgcctt ctcaccgcct       120
     gagcttgaag cgaaagccta tatcagggtg ttaatggaag agtgcggtct tgatgtgtat       180
     accgatgcgg tggggaatgt ttttggtgtt tatcagggca gggagcccga tttaccggtg       240
     attatgaccg gttcacatgt ggattcggtc atacgcggcg gggcctttga tggaaccctt       300
     ggggtgctcg gtgccattga ggctgtccgt acgatgaagg aagcgggtat ccggccgagg       360
     cggacgattg aaatcgtcag tttctccgac gaggaaggaa cgcggtttgg ggccggctat       420
     atgggcagta aggcccttgc aggaaagctc gacgaccgct ttctcaccct gaccgatcag       480
     gagggcgaga gctatgagac agttctgacg aaggcgggct atgagccgtc ggcctatcca       540
     aaggcaaagc gtgacagccg ggagatcggt gcttttcttg agatgcacat cgaacagggg       600
     cgtgtccttg aagaagcgga tattgccgca gggatcgtga caacgatcca gggaccgctc       660
     tggctccagg tgacgattga aggggcagca gatcacgccg gtgcgacacc gatggcgatc       720
     aggaaggatg catcgttggc catggctgag gcgatgcttg ccgtcgagga ggcggctgtc       780
     acacacggcg gggtcgggac cgtcggcagt ctcaaagtca aaccgggcgg gattaacatc       840
     atccctggcg aagtggtctt taccgtcgat atgcgccacg gggacaccac gcttcgcgat       900
     cggatgctta cggacatcga ggcctctttt tcggccatcg ccgggaaacg cggtgtcagc       960
     ttcaagacgt tggtcaccaa gaaagaaccg ccggccacct gttctgaaga tattcgggca      1020
     agtattcacc aggccgcaaa cacatgcgga attccggtga aagacatgcc ctgcggagcg      1080
     gggcatgatg cgctcattat gtcgacagtc acgagaatgg ggatgattct cgtccgcagt      1140
     caagacggga tcagccataa cccgcaggaa tggacgagtc aggaagactg tgcaaaaggc      1200
     acggagcttc tcatgcggac gcttcacagc ctggcagaag aaagagggga tgaagcatga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page