(data stored in ACNUC7421 zone)

EMBL: CP001791.PE57

CP001791.PE57        Location/Qualifiers
FT   CDS_pept        69779..71236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0058"
FT                   /product="MazG family protein"
FT                   /note="KEGG: geo:Geob_1879 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97609"
FT                   /db_xref="GOA:D6XV51"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV51"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADH97609.1"
FT                   /translation="MGTIRILGLGAGDLDQLSLGVYREIRQAEQLFVRTARHPLIAALE
FT                   DEGVSFESFDTIYETESAFSDVYARIAGALLEKAEATEATIFYAVPGHPLVAEETVQRL
FT                   LRQEQVPVSIAGGGSFLDAMFTTLNIDPIEGFQLLDGLSMEPSDLMLKGHTVIGQVYDS
FT                   LSASEVKLKLMERLPDDFDVTIVDAAGTDRESVTVVPLYELDRSVTTSNLTAVYVPPAE
FT                   EEAIHYRTFDTLRGVIRTLRGPDGCPWDREQTHESLKRYMIEEAYELLEAIDEEDDDHI
FT                   ADELGDVLLQVMLHAQIGEDNGYFSIDDVIGNLSEKMVRRHPHVFSDTSVSGADQVVTN
FT                   WEAIKAEEKGHEDRHSMLDGIPKGLPGLMTAAKLQKKAGKVGFDWGEEGPMWEKLFEEI
FT                   HEWAQEVHTGTPDRSMKEFGDVLFAFVNIARFHQIDPEEALRQTNEKFRRRFQHVESRV
FT                   EESGLDWSAFSLEALDRWWEEAKDKGL"
     atgggaacga tacgaatttt gggccttggc gcaggtgatc tcgatcagct gagtcttggt        60
     gtctacagag aaatcaggca ggcggagcaa ctgtttgtcc gcacagcccg tcacccgctc       120
     attgcggccc tcgaagacga aggcgtctcc tttgagagct ttgacacaat ttacgagaca       180
     gaatccgcct tttccgatgt ttatgcccgc attgccgggg cgcttcttga aaaagcggaa       240
     gccacggaag cgacgatctt ctatgctgtt ccgggtcatc ccctcgtcgc ggaagaaacc       300
     gtacagcgcc ttctccgtca ggaacaggtg ccggtttcga tcgccggagg ggggagtttt       360
     ctcgatgcga tgttcacgac gctcaacatc gatccgattg aaggttttca gctccttgac       420
     ggcctcagta tggagccgtc ggatctgatg ctcaaggggc atacggtcat cggtcaggtg       480
     tatgacagcc tcagtgcatc agaggtgaag ctgaagctga tggagcgact gcccgatgac       540
     tttgacgtca ccatcgttga cgctgcagga acggacaggg agtcggtcac cgtcgtccct       600
     ctctacgaac tcgacagatc cgtgacaact tcaaatctga cggcagtcta tgtgccgccg       660
     gcagaggagg aggcgattca ctacagaacg ttcgacactc tgcgcggcgt gatccgcacg       720
     ctccgtggcc ccgacggttg tccgtgggac agagaacaga cccacgaaag tctgaagcgg       780
     tatatgatcg aagaagccta tgagcttctt gaagccatcg atgaagagga cgacgatcac       840
     atcgcagatg agctggggga tgtccttttg caggtgatgc tgcacgctca gatcggtgaa       900
     gataacggct atttttccat cgacgatgtc attggcaacc tctcggaaaa aatggttcgc       960
     cgtcatcccc atgtcttttc ggacacgagc gtctccggtg ccgatcaggt cgtgacgaac      1020
     tgggaagcga tcaaagcaga ggagaaaggc catgaagacc ggcactcgat gctcgacggg      1080
     attccgaagg gattgcctgg tctgatgacc gcagccaagc ttcagaaaaa agccggcaaa      1140
     gtcgggtttg actggggtga ggaaggtccg atgtgggaaa agctgtttga agagatccat      1200
     gaatgggcac aggaagtgca caccggcaca ccggaccgtt cgatgaagga atttggagat      1260
     gtgctctttg cgtttgtcaa catcgcgcga ttccatcaga ttgatcctga agaagcgctc      1320
     aggcagacga atgagaagtt ccgccggcgg tttcagcatg tggaaagccg ggtggaggag      1380
     tcgggccttg actggtcagc cttctccctc gaagcgctgg accgctggtg ggaggaagca      1440
     aaagataaag gtttgtaa                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page