(data stored in ACNUC7421 zone)

EMBL: CP001791.PE574

CP001791.PE574       Location/Qualifiers
FT   CDS_pept        complement(634407..635162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0590"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: pmr:PMI0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98126"
FT                   /db_xref="GOA:D6XY53"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY53"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADH98126.1"
FT                   /translation="MTTFYNTLSSAVYNYDKAIGISFGDVGFYTSRLEGISGKILEPAV
FT                   GNGRLLIPLTEAGLTVDGFDLSEAMLSHCRQNCHDRGLSPHLWQDSMTTFTSNEQYEAI
FT                   ILPAGSFLLLPSHADGMEALRRFHDHLVPGGRLLIDLFLPDELNAGQESFRRFPLNNRE
FT                   TITLTSTVRSVDVVRQSVESYNRYEKWVDGKLTETELERFPVRWIGIEEAKLMLKEAGF
FT                   TDIRLSADYQMDKQPEQAGEMLTFEAVAK"
     atgaccacgt tttacaatac cctgtcctca gccgtctaca actacgataa agccattgga        60
     ataagctttg gcgatgtcgg gttttacaca agccggctcg aaggcatctc gggtaaaatc       120
     cttgaacctg ccgttggcaa cggacggctg ctcataccgt taaccgaagc cgggcttacg       180
     gtggatggtt tcgatctctc ggaggccatg ctcagtcact gccggcaaaa ctgccatgat       240
     cgcggccttt ctcctcatct ttggcaggac agcatgacca cattcacaag caatgagcag       300
     tatgaagcga ttattctccc ggcaggcagt ttcctgcttt tgccctctca tgcggacggt       360
     atggaagcct tgcggcgttt tcacgatcat ctcgtcccag gtggccgtct cctcatcgat       420
     ctgtttttac ctgatgagct caatgccggc caggaatcat tccggcgctt ccctttaaac       480
     aaccgtgaaa ccatcaccct cacaagcacc gtccgatcgg tggatgttgt ccgtcaatcc       540
     gtggaatcct acaaccgata cgagaagtgg gtggacggca agctgacgga aaccgagctc       600
     gagcgctttc cggtccgctg gatcggtatc gaggaagcaa agctcatgct gaaagaggcc       660
     ggctttactg acatcaggct ctccgccgat tatcaaatgg acaaacagcc ggaacaggcc       720
     ggtgaaatgt tgacattcga agccgttgcc aaataa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page