(data stored in ACNUC7421 zone)

EMBL: CP001791.PE576

CP001791.PE576       Location/Qualifiers
FT   CDS_pept        complement(635766..636116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0592"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: pca:Pcar_1345
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98128"
FT                   /db_xref="GOA:D6XY55"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY55"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADH98128.1"
FT                   /translation="MIASVLDAVVILVSVSFIIYGITCIGSVRMKQEFERFQLPGFAPW
FT                   IGILEITAGAAMLVGLAVPWLLLLASGGLTLLMAVAVFVRIRVGDTLWQSSPAVVFFLL
FT                   TAWLFFMTLQAL"
     gtgattgcct ctgtcctgga tgccgtcgtc attctcgttt cggtttcctt tatcatctat        60
     ggcattacct gtatcggctc tgtgagaatg aaacaggaat tcgaacggtt tcaactgccg       120
     ggatttgccc catggatcgg cattcttgaa attacagctg gcgcagccat gcttgtcggg       180
     ctcgccgttc catggctctt gcttcttgcc tccgggggac tgacgctcct catggccgtc       240
     gccgtcttcg tccgtattcg cgtcggtgac acgctttggc agtcctcccc cgctgttgtc       300
     ttcttccttc tcaccgcttg gctgtttttc atgaccttac aggctcttta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page