(data stored in ACNUC7421 zone)

EMBL: CP001791.PE580

CP001791.PE580       Location/Qualifiers
FT   CDS_pept        638636..640072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0596"
FT                   /product="cryptochrome, DASH family"
FT                   /EC_number="4.1.99.3"
FT                   /note="TIGRFAM: cryptochrome, DASH family; KEGG: cry-dash;
FT                   cryptochrome DASH; PFAM: DNA photolyase FAD-binding; DNA
FT                   photolyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98132"
FT                   /db_xref="GOA:D6XY59"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014133"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY59"
FT                   /inference="protein motif:TFAM:TIGR02765"
FT                   /protein_id="ADH98132.1"
FT                   /translation="MRMVNVIWFRHDLRIHDHEPLRLAHWAKEETEAVFVRDARMDEKV
FT                   TPGLKRAGEHRERFLMESLVVLAGSLEAEGMPFTVLKGPVVKTMIDWLTERGATDVFLH
FT                   EHPGFEERRDLEEVQRALPHIHWHVSEGHTMFRRDQLPFSFSEFPMSFTMFRKRLEAHL
FT                   RLPEKKRSFSYDSYDTVTEAEPVFLSGKESGSFGAVRGSGDHIPHAGGQGIVRGGEQEA
FT                   LARLRSYVGNASRLFTYKETRDGMFAFDDSSKLSFWLANGSLSPKRVYRAILDMEAANG
FT                   RNESSYWLFFELLWREYFQWLMLATDARLFTKQGLLDVAIVWHEDKALFQAWKDGETGF
FT                   PLVDAAMRELKATGYMSNRARQNAASFLTKNLGINWLWGARYFEEQLIDYDPASNYGNW
FT                   AYQAGVGTDLRELRAFNVIGQGIRYDPKGSYAKNWLHLPDTLPGHTVYDPVKLSAHTDW
FT                   PQPIVDLEESLERRKQELGL"
     atgagaatgg tgaatgtcat ttggtttcgt catgacttac gcatacatga tcacgaaccg        60
     cttcggctgg ctcactgggc aaaagaagaa acggaggccg tctttgtacg ggatgcgcgc       120
     atggacgaga aggtcacccc gggactcaaa cgtgccggtg aacaccggga gcggtttctc       180
     atggagagtc tggttgtcct tgccggatcc ctggaagcag aagggatgcc gtttaccgtc       240
     ctgaaggggc cggttgtaaa aacgatgatc gattggctca cggaacgtgg cgcaacggat       300
     gtttttctgc atgagcatcc gggttttgaa gaacggcggg atcttgagga ggtgcaaagg       360
     gcactgccac acattcactg gcatgtcagt gagggacata cgatgtttcg acgggatcag       420
     ctgcccttct ccttttcgga atttccgatg tcgttcacga tgttccgaaa gaggcttgaa       480
     gcacacctca ggttaccgga aaaaaagcgg tctttctcct atgactctta tgatacggtc       540
     acagaggcag agccggtttt cctgagcgga aaagagagtg gatctttcgg agcggtgcgg       600
     ggatccggtg accacattcc gcatgccgga ggacagggaa tcgtcagagg gggagaacag       660
     gaagcattgg cgcgcctccg gtcgtatgtt gggaatgcgt cacgattatt tacctacaaa       720
     gaaacgagag acgggatgtt cgcctttgat gacagttcaa agctttcgtt ttggcttgcg       780
     aacggcagtc tgtctcccaa gcgggtgtac cgggccattt tggacatgga ggcagcgaac       840
     ggacgaaacg agtcgagcta ctggctgttt tttgagcttc tctggcggga gtattttcag       900
     tggctcatgc ttgcgacaga cgcacgtctg tttacgaaac aggggctgct tgacgtcgcc       960
     atcgtctggc acgaagacaa ggccctgttt caggcatgga aagacggcga aacaggcttt      1020
     ccgctggtgg atgcggcgat gcgggagttg aaggcgaccg gatatatgag taaccgggcg      1080
     agacagaatg ccgcaagctt cctgacgaaa aacctcggca tcaactggtt gtggggtgcc      1140
     cgctattttg aagaacagct catcgactat gatccggcga gtaactacgg caactgggcg      1200
     tatcaggcgg gcgtcgggac ggatctgagg gaactgcgtg cgttcaacgt gattggtcag      1260
     ggcatccgct atgacccgaa aggaagctat gcgaagaatt ggctgcactt gccggatacg      1320
     ttgcccggtc acacggtata cgatcccgtg aaactgagtg cccatactga ctggccgcag      1380
     cccatagtcg atctggagga atcccttgaa cggagaaagc aagaactcgg tctctga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page