(data stored in ACNUC7421 zone)

EMBL: CP001791.PE59

CP001791.PE59        Location/Qualifiers
FT   CDS_pept        71627..72013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0060"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   geo:Geob_2927 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97611"
FT                   /db_xref="GOA:D6XV53"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV53"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADH97611.1"
FT                   /translation="MAADGKERLKQLTEEVERKHRMYEEALRKKRRGLMRRLSVFGVVM
FT                   LLMTGVSVFTIIHQNSQVTEQEELISSLKEEQDVLQEEERRLGREIESLHDPAYIAEIA
FT                   RRDFFLTKPGEILFQVPREGQSDD"
     atggctgcag atgggaagga acggctcaaa cagttaacag aggaagttga gcgtaaacac        60
     cggatgtacg aggaagcgct caggaaaaaa aggcgtggcc tgatgcgccg gctgtcggtc       120
     tttggggtcg ttatgctgct tatgacgggt gtttcggtat ttaccatcat ccaccagaac       180
     agtcaggtga ccgaacagga agagctgatc agcagtctca aagaagaaca ggatgtcctg       240
     caggaggaag aacgccgcct tggccgtgaa atcgaatcgc tccatgatcc ggcttacata       300
     gcggaaatcg cccgacggga tttctttttg acgaaaccgg gcgagatcct gttccaagtc       360
     ccccgtgaag ggcaaagtga cgattga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page