(data stored in ACNUC7421 zone)

EMBL: CP001791.PE60

CP001791.PE60        Location/Qualifiers
FT   CDS_pept        72085..72507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0061"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG: S1 RNA
FT                   binding domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97612"
FT                   /db_xref="GOA:D6XV54"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV54"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADH97612.1"
FT                   /translation="MSIEIGSKVEGKITGITHFGAFVELPGKKTGLVHISEVADGYVEN
FT                   IKDVLTVGDTVTVKVLKIADDGKIALSIRKAAEKPAGEKPRRRPPGKPSGGDRRQEGTK
FT                   GSFEDKMSRFLKDSEERLSTLRKQTDSKRGGRSTKR"
     atgtccatcg aaataggcag taaggttgaa ggaaaaatca caggtatcac ccattttggg        60
     gcgtttgttg agcttcccgg caaaaagacg ggactcgtgc acatcagtga agtggcagac       120
     ggctacgtcg agaacatcaa ggatgtgctg accgttgggg atacggtcac ggtgaaggtg       180
     ttgaagattg ccgatgacgg gaagatcgcc ctgtccatcc gtaaagccgc agagaaacct       240
     gccggagaaa aaccgcggag acgtccaccg ggcaagcctt ctggcggaga tcgcagacag       300
     gaaggaacca aaggctcctt tgaagataaa atgagccggt tccttaagga cagcgaagag       360
     cggttatcca cattgcggaa acagacggac tccaagcgcg gaggacgaag tacaaagcgc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page