(data stored in ACNUC7421 zone)

EMBL: CP001791.PE61

CP001791.PE61        Location/Qualifiers
FT   CDS_pept        72669..73430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0062"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   prw:PsycPRwf_2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97613"
FT                   /db_xref="GOA:D6XV55"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV55"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ADH97613.1"
FT                   /translation="MSERADEMMDICLLAGEIMLSYGAETYRVEETLERMSVAAGFANV
FT                   HCFATTTGIFLSFEEKKGNGDLMQMVRIDNRMQDLNKVMEVNQVSREFTSGDLTIPEAH
FT                   ERLKEIYHAPVLYPLWVIHLFAGVAGSGFSYLFGGGLFDLLPAYIAAVASSVALVEFER
FT                   YLKVRFASEFMGAFTGGTVAILLVMFGLGNNLDQIIIGSLMPLVPGVPLTNSVRDLLSG
FT                   DLLAGMSRGVEALLTSLSIAGGVALTISIFL"
     atgtcggaac gggcggatga aatgatggat atatgcctct tggccggtga gatcatgctg        60
     agctacggcg cagaaacata ccgcgtggaa gagaccctcg agcggatgtc cgtggcggcc       120
     ggcttcgcca atgtccactg ctttgcgacg acgacgggca ttttcctctc ctttgaggag       180
     aaaaagggga acggtgacct gatgcagatg gtccgtattg ataaccggat gcaggattta       240
     aacaaagtga tggaggtcaa ccaggtgtcc cgggagttta cctccgggga cttgacgatt       300
     cctgaggccc acgagcggct gaaggaaatc tatcatgcac cggtgctcta tccgctttgg       360
     gtgatccatc tgtttgccgg ggtcgcgggc tccgggtttt cctatctgtt tggcgggggg       420
     ctctttgacc tcttgccggc ttatattgca gcggttgcgt cgagcgtggc ccttgttgaa       480
     ttcgagcggt atctgaaagt ccgctttgct tcggagttta tgggtgcctt caccgggggg       540
     acggtggcca tcctcctggt catgttcggg ctcggtaaca atctcgatca gatcattatc       600
     gggtccctca tgcccctcgt ccccggggtg cctttgacca actccgtccg tgacctcctg       660
     tccggagatc tccttgccgg gatgagccgc ggggtggagg cactcttaac ctcgctgtcg       720
     attgccggcg gtgttgcact gacgatttca attttcctgt aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page