(data stored in ACNUC7421 zone)

EMBL: CP001791.PE62

CP001791.PE62        Location/Qualifiers
FT   CDS_pept        73447..73899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97614"
FT                   /db_xref="GOA:D6XV56"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV56"
FT                   /inference="similar to AA sequence:KEGG:Abu_0318"
FT                   /protein_id="ADH97614.1"
FT                   /translation="MVTFILQLIITFAATVAFGILFNVPKRALLIGGAIGVCTWAVLSI
FT                   SMMLGAAQVVSTGLASISAAVNAHFLARKLKLPVTTLSIPGILPLVPGSRAYFTMLAFV
FT                   DGDYLQGLEYGVETMLIAGAIAGGLVVGLSIFTFGKGGSHRYESNH"
     atggtgacat ttattctgca actgatcatt acctttgctg caactgtggc attcggcatt        60
     ctctttaatg tgccgaagcg cgcccttctg atcggcggtg ccatcggggt ctgtacgtgg       120
     gcggtgttga gtatttccat gatgctcgga gcggctcagg tcgtatcgac gggtcttgcg       180
     tccatctctg cggcagtcaa tgcccatttc cttgcgcgaa aactgaagct gccggtgacg       240
     accctctcca ttccagggat cctcccgctt gtacccggaa gccgtgccta cttcacgatg       300
     ctcgcttttg tggacggtga ctacctgcag ggacttgaat acggtgtgga aacgatgctc       360
     attgccggtg ccattgccgg cggactcgtt gtcggactct cgatctttac attcgggaaa       420
     gggggcagcc accgttatga atcaaaccat tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page