(data stored in ACNUC7421 zone)

EMBL: CP001791.PE63

CP001791.PE63        Location/Qualifiers
FT   CDS_pept        73883..75310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0064"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: sat:SYN_02776 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein; Protein of unkown function DUF1946 PP-loop
FT                   ATpase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97615"
FT                   /db_xref="GOA:D6XV57"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV57"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADH97615.1"
FT                   /translation="MNQTIDAFIDRHRLIQAGDHLLVAVSGGVDSMVLLHLLHERRTRL
FT                   SITLSAVHAHHHLRRESADRDAELVASFCRELAIPFHLVHLSVEEERKLRNGSVQAVAR
FT                   DLRYEAFRHVMTETGANRLVTAHHGDDQIETVLLQLLRNTAQGGSGMRALRPIEGGTLI
FT                   RPLLDTEKASLYRYAKDSGIPFREDESNDSRHYRRNRIRQDILPVLKEEHPGIHRQIGR
FT                   YTEERQTESDYLDHLADEMLQEPSFSLMMKESGLQFSRPAFQRLPSALQKRAVHLLLTY
FT                   LSEHLRIRVAHNRRNLEQAVAVICGEKPNAAAFFHDGLKLVCAYGLVTIGLTDESLDSF
FT                   SSFVIQGEGEWVLPTGTLSCRLSETEDPLPETSAQAVTVPGQMLPITVRPRKPGDRITL
FT                   RSGEGRKKLKKIMIDEKIPQSMRDVWPILVDRHDTILWAPELAVSGELLRIETGHQENR
FT                   HFHIRFQRFEHETAILE"
     atgaatcaaa ccattgacgc gtttatcgac cgtcaccggt tgattcaggc cggtgatcat        60
     cttcttgttg ccgtctcagg gggcgtcgac agcatggtcc ttcttcacct tcttcatgaa       120
     cggcggacac ggctttcgat caccctctca gccgtccatg cccaccatca cctgaggaga       180
     gaaagcgccg accgtgatgc agaactcgtt gcatcgtttt gcagggaact tgcgataccg       240
     tttcatctcg ttcatctttc ggtagaggaa gaacgaaagc ttcgtaatgg atcggtccag       300
     gcggttgcca gggacctccg ttacgaagct tttcgtcatg tcatgacaga aaccggggca       360
     aaccggctgg tcacggccca tcacggggac gaccagatcg aaacggtgct gcttcagctg       420
     cttcggaata cggcccaggg cggaagcggg atgcgagcgt tgcgcccgat tgaaggcggg       480
     accctgatcc ggcccctttt ggacacagag aaagcctcac tctaccggta cgccaaggac       540
     agcggcattc cttttcgtga agatgagtcg aatgacagcc ggcattaccg gcgaaaccgg       600
     atccgccagg atatcctgcc ggttttaaaa gaggagcatc cgggtattca tcggcagatc       660
     ggccgttata cggaagagcg gcagacagag agcgattatc tcgatcatct ggcagacgaa       720
     atgcttcagg agccgtcttt ttctcttatg atgaaagagt cgggcctgca attctcccgg       780
     ccggcctttc aaagactgcc ttccgcttta caaaagcggg ctgttcatct actattaact       840
     tatctttctg agcatttgcg aatccgggtg gcgcataacc gccggaatct cgaacaggcc       900
     gtggctgtca tttgcggaga gaagccgaat gcagcggctt tttttcatga cggattgaag       960
     ctcgtctgtg catacgggct tgtcacgatc ggcttgaccg atgagtcttt ggattcgttt      1020
     tcctcttttg tgatacaagg agaaggcgaa tgggtgctgc cgacagggac actgtcctgc      1080
     cggctgtctg agaccgaaga tccgctaccg gaaacgtccg ctcaggctgt gacggttccc      1140
     ggacaaatgc tgccaatcac cgtgagaccc cgtaaacccg gggaccggat cacgcttcgg      1200
     agtggcgaag gccgcaagaa gctgaaaaaa atcatgattg atgaaaaaat tcctcaatcg      1260
     atgcgtgatg tttggcccat tctggtggac agacatgata caatattatg ggctcctgaa      1320
     ctggccgtat ccggagaact gctcaggatt gagaccgggc atcaggagaa caggcacttt      1380
     cacattcggt ttcaacgctt tgaacacgaa accgctatac ttgaataa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page