(data stored in ACNUC7421 zone)

EMBL: CP001791.PE65

CP001791.PE65        Location/Qualifiers
FT   CDS_pept        75947..77992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0066"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: pca:Pcar_0997 ATP-dependent
FT                   zinc protease/cell division protein; PFAM: peptidase M41;
FT                   peptidase M41 FtsH extracellular; AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97617"
FT                   /db_xref="GOA:D6XV59"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV59"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADH97617.1"
FT                   /translation="MNRIFSNTLFFLLIFLVIVGIVSLFSQEPGDTSEMSFTEFKQEFQ
FT                   EGNVESLSIQPNLDVYSARGQLEGAAEDEFFTVNIPDLQVFLEDIVTASGSESLNELTI
FT                   EPADEPSGWITFFTVLIPFIIIFILFFFLISQSQGGGSKVMNFGKSKAKLVSEDKKKAR
FT                   FKDVAGADEEKQELEEVVEFLKEPRKFAEIGARIPKGVLLVGPPGTGKTLIARAVAGEA
FT                   GVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRRRGAGLGGGH
FT                   DEREQTLNQLLVEMDGFGVNEGIILIAATNRADILDPALLRPGRFDRQIMVGRPDVKGR
FT                   EAVLEVHAKNKPLADDVELKTIAQRTPGFSGADLENLLNEAALVAARTDKKKIDMESVE
FT                   EAIDRTIAGPSKKSRVISEKEKNIVAHHEAGHTVVGVKLVNADMVHKVTIVPRGQAGGY
FT                   AMMLPREDRYFMTKPELIDKIVGLLGGRVAEEVMFDEVSTGAHNDFQRATGIARKMVME
FT                   YGMSDKLGPVQFGNSQGEVFLGRDINSEQNYSEAIAHEIDMEVQRIIKEAYAYCKEILT
FT                   EHKDKLELVAQMLIEYETLDAEQIYSLVEEGKMPENHHMIKKLNGESEEQQVDSDEQHK
FT                   EDDASESDGETAESGDTSEVDKADQPTDTEDAGDRDEPSTDDDERK"
     atgaaccgta ttttcagtaa tacgttattc ttcctgctga tttttctcgt gatcgtcggt        60
     atcgtcagtc tgttttcgca agaacctggt gatacgtctg agatgtcttt tacggaattc       120
     aagcaggagt tccaggaagg gaatgtggaa tcgttatcca ttcagcccaa tctggatgta       180
     tattcagccc gcggtcagct tgaaggcgcg gcggaagatg agttttttac agtaaacata       240
     ccggatcttc aggttttcct tgaagatatc gtgactgcaa gcggaagtga aagcctgaac       300
     gaattgacca ttgagccggc ggatgagccg agcggctgga ttacattctt cacggtactg       360
     attccgttta tcattatctt tatcctcttc ttcttcctga tcagccagtc tcagggtggc       420
     ggcagcaagg tgatgaactt cggtaagagt aaggcgaagc tcgtcagtga agacaagaag       480
     aaggcccggt ttaaagacgt ggccggtgcg gatgaagaga agcaggaact cgaagaagtc       540
     gtcgaattcc tgaaagaacc gcgcaagttc gcggagatcg gtgcccgtat tccaaaaggg       600
     gtgctccttg tcggacctcc gggtacaggt aagacgctga ttgcccgtgc ggttgccggg       660
     gaagcaggcg taccgttctt ctccatcagc ggttcggatt tcgttgagat gttcgtcggt       720
     gtcggggcat cccgtgtccg tgacctcttc gaaaatgcga agaagaatgc gccgtgtatc       780
     attttcatcg atgaaattga cgcagtcgga cgtcgccgtg gcgcaggcct tggcggtgga       840
     cacgatgagc gtgaacagac actgaaccag cttctcgttg agatggacgg tttcggtgtg       900
     aacgaaggga tcattctgat cgcggcgacg aaccgtgcag acatccttga cccggcgctc       960
     ctccgtcctg gccgtttcga ccgtcagatt atggtcgggc gaccggatgt caaaggacgc      1020
     gaagccgtcc ttgaagtcca tgcaaagaat aagccgcttg ctgacgatgt ggaactgaag      1080
     acgatcgctc agcggacgcc aggattctcc ggtgcggatc tcgagaacct tctgaacgaa      1140
     gcggcactcg ttgcagcccg tacggataag aaaaaaattg acatggaatc cgttgaggaa      1200
     gccattgacc gtaccattgc cggaccgtcg aagaagagcc gtgtcatctc tgaaaaagag      1260
     aagaatatcg tcgctcacca cgaagcgggt cataccgttg tcggcgtgaa gcttgtcaat      1320
     gcggatatgg ttcacaaggt gacgatcgta ccgcgcggtc aggccggcgg atatgcgatg      1380
     atgcttccta gagaggaccg ctacttcatg acgaagccgg aactgatcga caagatcgtt      1440
     ggactcctcg ggggccgtgt tgccgaagaa gtcatgtttg acgaagtgag cacaggtgct      1500
     cacaatgact tccagcgtgc gacaggcatc gcccgtaaga tggtcatgga atacggcatg      1560
     agtgataagc tcggtccggt ccagttcggt aactctcagg gtgaagtctt cctcggccgc      1620
     gacattaaca gcgaacagaa ttacagtgaa gcgatcgctc acgagattga tatggaagtg      1680
     cagcgcatca tcaaagaagc gtacgcgtac tgtaaagaaa ttctgacgga gcataaagat      1740
     aagctcgaac tggtcgcgca gatgctcatt gaatatgaga cgctcgatgc cgaacagatc      1800
     tattcccttg tggaagaggg caagatgccg gaaaaccatc atatgatcaa aaagctgaac      1860
     ggagaatcag aagagcaaca agtcgattct gacgaacagc ataaagagga tgatgcgtct      1920
     gaatcggatg gggaaaccgc tgaaagcggg gacacttcgg aggtagacaa ggcggatcag      1980
     ccaactgata cggaagatgc cggtgacaga gacgaaccat cgacagacga tgatgagcgc      2040
     aagtaa                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page