(data stored in ACNUC7421 zone)

EMBL: CP001791.PE69

CP001791.PE69        Location/Qualifiers
FT   CDS_pept        82413..83009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0071"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: gur:Gura_1732 anthranilate synthase component
FT                   II; TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97621"
FT                   /db_xref="GOA:D6XV63"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV63"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADH97621.1"
FT                   /translation="MIVMIDNYDSFTYNLVQYLGEMGEELVVKRNDQVTLEEIEDLAPD
FT                   FLMISPGPCSPDEAGISMDVIRHFAGKIPVFGVCLGHQSLAQVFGGDVVQAERLMHGKT
FT                   SPVLHDGKTIFQGLESPFTATRYHSLIVKRETLPDCLEISAETAEGEIMALRHKEFAVE
FT                   GVQFHPESIMTDTGKQLLRNFLDVHRQGEAPCTSK"
     atgatcgtga tgattgataa ctatgattcg tttacgtata acctggttca gtatttgggt        60
     gaaatgggtg aagagcttgt ggtcaaacgg aatgaccagg tgacccttga ggagattgag       120
     gaccttgcgc cggattttct catgatttca ccgggtccct gttcaccgga tgaagcgggc       180
     atcagcatgg acgtgatccg gcattttgcc gggaagatcc ctgtctttgg cgtatgtctc       240
     ggccatcagt ctctcgccca ggtatttggc ggcgacgtcg ttcaggcgga gcggctgatg       300
     cacggcaaga cctccccggt tctccatgac ggcaagacga tttttcaggg gcttgagagc       360
     ccgttcaccg caacccgcta ccattccctg atcgtgaaga gggagacgtt gccggactgt       420
     ctggagattt cggcggagac ggcggaaggg gagattatgg cccttcgtca taaggaattt       480
     gccgttgaag gcgtgcagtt ccatccggaa tcgattatga cggataccgg gaaacagctt       540
     ctccggaatt ttctcgacgt gcaccggcag ggtgaagcac catgtacatc aaagtaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page