(data stored in ACNUC7421 zone)

EMBL: CP001791.PE7

CP001791.PE7         Location/Qualifiers
FT   CDS_pept        7401..9908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: gur:Gura_0005 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97559"
FT                   /db_xref="GOA:D6XV01"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV01"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADH97559.1"
FT                   /translation="MSDQDQSRVTEINISQEMRTSFMDYAMSVIVSRALPDVRDGMKPV
FT                   HRRILYAMNELGITSDKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDSAAAMRYTEARMSKISMELLRDINKDTIDYQDNYDGSEREPVVLPAR
FT                   FPNLLVNGASGIAVGMATNIPPHNLSEVIDGVLALSKNPEITIEQLMEHISGPDFPTGA
FT                   EIVGISGIRRAYETGKGSIMIRSNARIEDHNGKPWIIVDELPYQVNKARLIEKIAELVR
FT                   DKKIDGITDLRDESDRTGMRIVIELRRDVNANVLLNNLYKQTALQTSFGINTLALVNGR
FT                   PQVLNLKETLVHYLDHQRVVIRRRTEFELRKAEARAHILEGLRVALDHLDEVIALIRGS
FT                   QTTDIARDGLMEQFDLSHDQAQAILDMRLQRLTGLERDKIENEYNELMARIAELKAILA
FT                   DDEKVLEIIREELLEIRDRFGDDRRTTITFGEDSMEDEDLIPRQNVVITVSHHGYIKRI
FT                   PVSTYRSQKRGGRGVQGMGTHDEDFVRHLFVTNSHDHMLFFTNKGKVYRMKGYEVPEQK
FT                   RTSKGIPIINLLQIEKDEYISTVIPISEFDANHSLIFMTKYGVSKRTELDAFKNIRKGG
FT                   LFAIKLREGDELHGVRLTDGSKELVVGTKKGMSIRFSETDVRLMGRTATGVKGLRLQSE
FT                   DEVVGMDIIEPDSDILIVTENGFGKRTPIDEYRQQSRGGKGIKTCNITDKNGQLVSLKV
FT                   VGSDHDLMMITTNGVLIRIHVSDISKTSRNTQGVRLIRLGDEEFVSTVARVNVNDDDVE
FT                   DADDPDADEVESDVEHIEETEED"
     atgtctgatc aagatcagtc ccgcgtcaca gaaatcaata tcagccagga aatgcgcaca        60
     tcatttatgg actatgccat gagtgtcatc gtcagccgtg cccttcctga tgtgagggat       120
     ggcatgaagc cggttcaccg gcgtattctc tatgccatga atgaactcgg catcacatcg       180
     gataaggctt ataaaaaatc tgccagaatc gtcggtgaag tcatcggtaa ataccacccg       240
     cacggtgact cagccgttta tgaaacgatg gtccgtatgg ctcaggattt cagctaccgg       300
     aatatgctcg tcgacggtca cgggaacttc ggttctgtgg acggggattc tgcagcggcc       360
     atgcgttaca cggaagcacg gatgtccaaa atctccatgg aactgcttcg tgatatcaac       420
     aaagatacca tcgattatca ggacaactat gacgggtcgg aacgtgagcc cgtcgtattg       480
     cctgcccgtt ttccaaacct gctcgtcaac ggtgcatccg gcatcgcggt cgggatggcg       540
     acgaatattc cgccgcacaa cctctcagaa gtcattgacg gtgtcctggc actcagtaaa       600
     aatcctgaga tcaccatcga acagctgatg gaacatatca gtggtcctga ctttccgaca       660
     ggcgcagaaa ttgtcggcat ctccgggatc cgtcgagcct atgagacagg taaaggctcc       720
     atcatgatcc gttcgaatgc ccgtattgaa gatcacaacg ggaaaccgtg gatcattgtt       780
     gatgaactgc cgtaccaagt caacaaagca cgtctgattg aaaaaattgc ggaactcgtc       840
     cgtgataaaa agatcgacgg cattacggac ctccgggatg aatcagaccg gacagggatg       900
     cgcatcgtta ttgaacttcg ccgcgatgtg aatgcgaacg ttctgttaaa caatctctat       960
     aagcagaccg ccctgcagac gagcttcggg atcaacaccc ttgctcttgt caacggacgt      1020
     ccgcaagtat tgaatctgaa agaaaccctc gttcattatc tcgatcacca gcgggtggtc      1080
     atccgaagac gaacggaatt tgaactgcga aaagcggaag cgcgggccca tattcttgaa      1140
     ggtctccgcg ttgccctcga tcaccttgat gaagtcattg cactgatacg cggttcacag      1200
     acaaccgata tcgcgcgtga cggactcatg gagcagtttg acctttccca tgatcaggcc      1260
     caggcgattt tggacatgcg tcttcagcgt ctgaccggtc tcgagcggga taaaattgag      1320
     aatgaatata atgaactcat ggcacgcatt gcagaattaa aagcaattct tgccgatgat      1380
     gagaaagtgc ttgaaattat tcgtgaggag ctccttgaga tccgtgaccg tttcggcgat      1440
     gaccgccgga caacgatcac attcggcgag gacagcatgg aagatgaaga cctcattcca      1500
     aggcaaaacg ttgtgatcac agtcagtcat cacggttaca tcaagcggat tccggtatcg      1560
     acctatcgtt cgcaaaagcg cggtggccgt ggtgtgcagg gaatgggcac tcatgatgag      1620
     gactttgtcc gtcatttgtt cgtgacgaat tcccatgatc acatgctctt tttcaccaat      1680
     aaagggaaag tataccggat gaaaggctat gaagtgccgg aacaaaagcg gacttccaag      1740
     ggaatcccga tcattaatct tttgcagatc gaaaaagatg aatacatttc aacggttatt      1800
     ccgatttcag aatttgatgc aaatcactct ctgattttta tgaccaagta cggtgtatca      1860
     aaacggacgg aactcgatgc tttcaaaaac atccgtaaag gcggtctatt tgcgatcaag      1920
     cttcgtgaag gcgacgaact tcacggggtc cgtctcaccg atggcagcaa agaacttgtt      1980
     gtcggtacga aaaaaggcat gtcgatccgt ttcagtgaga cggatgtccg gctgatgggc      2040
     cgaacagcca caggcgtcaa agggcttcgt cttcagagtg aggatgaagt ggttggcatg      2100
     gatatcattg agccggattc agatattctg atcgttacgg aaaacggctt cggtaaacgg      2160
     actccgatcg atgaataccg tcagcagtcc agaggcggta aaggcattaa gacatgcaac      2220
     attaccgata agaacggtca gctcgtttca ctgaaagtgg tgggaagtga ccatgatctg      2280
     atgatgatca ccacaaatgg cgtcctgatc cggatccatg tatcagatat ttcgaaaaca      2340
     agccgaaata cgcagggcgt tcgtctgatc cgtctcggag atgaagagtt tgtttccacg      2400
     gtagctcgtg tcaacgtcaa tgatgatgac gttgaggacg cagatgaccc cgatgcggac      2460
     gaagtggaat cagatgtgga acacattgaa gaaaccgagg aagactga                   2508
//

If you have problems or comments...

PBIL Back to PBIL home page