(data stored in ACNUC7421 zone)

EMBL: CP001791.PE70

CP001791.PE70        Location/Qualifiers
FT   CDS_pept        82994..83854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0072"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: hch:HCH_06836
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97622"
FT                   /db_xref="GOA:D6XV64"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV64"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADH97622.1"
FT                   /translation="MYIKVNGTIIPEEEARISPLDHGFLYGMGLFETFRTYDGHPFLLD
FT                   EHMKRLREGADEMNIQLPAYDRQDVVETIRALLAANKNRDLYFRWNVTAGHGGVGLTAE
FT                   PYEEPGELVFVKDAPTPPATKQARVLTQTRNTPEGAVRRKSHHYMNSMLAKQELGQDPG
FT                   TEGMMLTSDGHVSEGIVSNVFWVKKDTLYTPSLETGCLPGVTRAWVADYADKQRLPFQE
FT                   GFFTAADMMQAEAVFVTNAIQEIVPVTAIDGRPFDSQTNPHLLALKQQYEIDKKQAYSL
FT                   GECGL"
     atgtacatca aagtaaatgg cacgatcatc ccggaggaag aggcgagaat ctcgcctctc        60
     gatcacgggt ttttgtatgg aatgggcctg tttgaaacgt ttcggacgta cgatgggcac       120
     ccgtttttac tcgatgaaca tatgaagcgc ctccgtgaag gggcggacga gatgaatatc       180
     cagcttcctg cctacgacag acaggatgtg gttgagacaa ttcgagcgtt gttggctgcc       240
     aacaagaacc gggatctcta cttccgttgg aatgtcaccg ccggacatgg cggtgtcgga       300
     ttaacggcag aaccgtatga agaaccgggg gagctcgttt ttgtgaaaga tgccccgacg       360
     ccgcctgcaa caaagcaggc cagggtgctg acgcagacac ggaacacccc ggaaggcgcg       420
     gtccgccgga aatcccacca ttatatgaac agcatgctcg ccaagcagga actcggtcag       480
     gatccgggca ccgagggcat gatgctcacc tcagatggcc atgtatcaga ggggattgtg       540
     tcgaacgtat tttgggtaaa gaaagatacg ctgtatacac cgtcccttga aacaggctgc       600
     ctgccggggg tgacccgggc ctgggtggct gattatgcag ataaacagcg attgccgttt       660
     caggaagggt tttttaccgc ggcggacatg atgcaggcgg aggccgtgtt tgtcacgaat       720
     gcgatccagg aaatcgtgcc ggtgacggcc attgacggtc gcccgtttga cagtcagacg       780
     aatccgcatc ttcttgcctt gaaacagcag tatgagattg ataaaaagca ggcttattcc       840
     ctcggagagt gcggcctgta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page