(data stored in ACNUC7421 zone)

EMBL: CP001791.PE71

CP001791.PE71        Location/Qualifiers
FT   CDS_pept        83888..84748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0073"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   geo:Geob_3422 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97623"
FT                   /db_xref="GOA:D6XV65"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV65"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADH97623.1"
FT                   /translation="MMKEYFSTMKWDRYELNFADKTLIMGILNVTPDSFSDGGKFQSEQ
FT                   EWQDRAKEMVRQGADIIDIGGESTRPGSTPVPADEELGRVIPAIRAIRSVVDVPISIDT
FT                   YKSDVAEAAIQAGASIINDVWGARYDSGMAEVAARFDVPIILMHNRERMDYTDLITDMK
FT                   EDLRKSVRIAKEAGVKDERIILDPGIGFAKTYEDNLTVMRELDAFMDLGYPMLLGTSRK
FT                   SLIAKTLNLPVHERVEGTGATVCLGIEKGCDIVRVHDVLEMSRMARMMDVMIGKSQVPL
FT                   EKSGA"
     atgatgaagg aatatttcag tacgatgaag tgggaccgct atgaactgaa ttttgccgac        60
     aaaacgctga ttatgggtat tttgaatgta acccccgatt cattctctga cggagggaag       120
     ttccagtccg aacaggaatg gcaggaccgt gcgaaggaaa tggtccggca gggtgcagat       180
     atcattgata ttggcggaga atcgacgaga cccggttcca caccggttcc ggcagacgaa       240
     gaactcggtc gggtcatacc ggcgattcgg gccatccgtt ctgtggtgga tgtgccgatc       300
     tccatcgata cgtacaaatc tgacgtggca gaagcggcga ttcaggcggg tgcatcgatc       360
     atcaatgatg tgtggggtgc ccgctacgat tcgggaatgg ctgaagttgc ggcacggttt       420
     gatgtcccga ttatcctgat gcacaaccgc gagcggatgg attacacgga tctgattacg       480
     gatatgaaag aagatcttcg taagagtgtc cgcattgcca aggaagcggg ggtgaaggat       540
     gagcggatca tccttgatcc cgggatcggg tttgccaaaa cgtatgagga taatctcacg       600
     gtgatgcgtg aactcgatgc ctttatggac cttggctatc cgatgctcct cgggacgtca       660
     agaaagtctc tgattgcgaa gacgctcaac ctccctgtgc acgagcgggt ggaaggcacg       720
     ggtgcgacgg tttgccttgg aattgagaaa ggctgcgaca tcgtcagggt tcatgacgtc       780
     ctcgagatga gccgcatggc aagaatgatg gatgtgatga ttggaaaaag ccaggtgccg       840
     ctggagaaaa gtggcgcatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page