(data stored in ACNUC7421 zone)

EMBL: CP001791.PE73

CP001791.PE73        Location/Qualifiers
FT   CDS_pept        85137..85658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0075"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: pca:Pcar_0250
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97625"
FT                   /db_xref="GOA:D6XV67"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV67"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADH97625.1"
FT                   /translation="MHTDAAKHAFIAFGSNQGERIDCLKKALKALSDHPDLSLVDVSAI
FT                   YETAPVGMTDQPSFLNMVAVFHSKLTAEALLNVTQSIEQDGGRERKERWGPRTIDLDIL
FT                   RHGTDTVDTAHLQIPHPRMMERAFVLVPLLDVAHHDPALCEDTLHEALKGCADRADVKR
FT                   ISDGLPDVDA"
     atgcacactg atgcggcaaa gcatgctttt atcgcgttcg gctccaatca gggggagcgg        60
     atcgattgtc tgaagaaagc cctgaaggcc ttgagcgacc accccgacct gtcgctggtg       120
     gacgtttctg cgatctatga gacggcccct gtcggcatga ccgatcagcc gtctttttta       180
     aatatggtcg cggtcttcca ctcgaagctg actgccgaag cacttttgaa cgtgacccag       240
     tcgattgaac aggacggggg gcgtgagcgc aaggagcggt ggggtccgcg aaccattgat       300
     ctcgatatcc tccgtcacgg aaccgatacg gtcgatacgg cgcatttgca aatcccgcat       360
     ccgcgtatga tggagcgggc ttttgtcctg gttccgcttc tcgatgtggc ccatcacgat       420
     cctgctctat gcgaagatac actgcacgag gccctcaaag gatgcgctga cagagcggac       480
     gtcaagcgga tttctgacgg gctgccggac gtggatgcat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page