(data stored in ACNUC7421 zone)

EMBL: CP001791.PE74

CP001791.PE74        Location/Qualifiers
FT   CDS_pept        85693..86691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0076"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: fph:Fphi_1896 tRNA-dihydrouridine synthase;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; NADH:flavin
FT                   oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97626"
FT                   /db_xref="GOA:D6XV68"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV68"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADH97626.1"
FT                   /translation="MTLSIGEITLKNPVVLAPMAGVCNPAFRLIAKEFGTGLVCAEMVS
FT                   DKAILHQNKRSINMLYVAEREKPLSLQIFGGTKETLVEAAKIVDTQTNADIIDINMGCP
FT                   VPKVTSCDAGARWLLNPDRIYEMVDAVVQAVDKPVTVKMRKGWDDDTVYAVDNAKAVEA
FT                   AGGKAIALHGRTRVQMYEGEADWSIIKTVKEAVGIPIIGNGDVQTPEDAKRMMTETGAD
FT                   GVMIGRAALGNPWMLYRTIHFLETGENIAEPSPEEKMRVAILHMDRLIDWKGERVAVKE
FT                   MRKHASYYMRGIRGAAKLRDQVNQMETREEMAGVMERIGLLDQERIPAGGS"
     atgactttat caattggaga gattaccctg aagaatcccg tagtactcgc gcctatggcc        60
     ggggtatgca accctgcctt tcgcctgatt gccaaagaat tcggcacagg actcgtttgt       120
     gcggaaatgg tcagtgacaa ggcgattctt catcagaata aacgttccat caatatgttg       180
     tatgtggctg agcgggaaaa gccgctcagc ctgcaaattt tcggggggac gaaagagacc       240
     cttgtggaag cggcgaaaat cgtcgacacc cagacgaacg cggacattat tgatatcaac       300
     atgggctgtc cggtcccgaa agtgacgtcc tgtgacgcag gtgcccgctg gctgttaaat       360
     cccgaccgga tctatgagat ggtcgacgcc gtcgtacagg cagtcgacaa gcctgtcacc       420
     gtcaaaatgc gcaaaggctg ggatgacgat accgtctacg ccgttgacaa tgcgaaagct       480
     gtagaagcag cgggaggaaa agcgattgcc ctgcacgggc gtacccgcgt gcagatgtat       540
     gaaggcgaag cggactggtc catcatcaaa acggtcaaag aggctgtcgg tattccgatt       600
     atcggaaatg gcgatgtgca gaccccggaa gatgccaaac gcatgatgac ggaaacagga       660
     gcagacggtg ttatgatcgg ccgcgcagcc ctcggtaatc catggatgct ctacagaacg       720
     attcatttcc ttgaaaccgg cgaaaacatc gccgagcctt caccggaaga aaagatgagg       780
     gtggcgattc tgcatatgga tcgcctcatt gattggaagg gtgaacgtgt cgccgtgaaa       840
     gaaatgcgta agcacgcttc gtattacatg agagggatcc gcggggcggc gaagctccgt       900
     gatcaggtca atcagatgga aacccgcgaa gagatggcgg gcgtcatgga aaggattggc       960
     ctgctcgatc aggaacggat acctgccggc ggatcatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page