(data stored in ACNUC7421 zone)

EMBL: CP001791.PE78

CP001791.PE78        Location/Qualifiers
FT   CDS_pept        102994..103533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0081"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97630"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV72"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ADH97630.1"
FT                   /translation="MLCQECQHYPATLHFTKIVNGEKMEMHLCETCAKDKGDYVPGSNS
FT                   FSIHQLLSGLMDQDASFPPKTDGSEQTRRPELQCPECGMTYRQFGEGGRFGCAVCYETF
FT                   DDKLDPVLARIHGGNHSHTGKIPKRQGKDLHLFREIEEQKEKLRKLIDEEAFEEAAAVR
FT                   DRIRELRQKTEQKEDE"
     atgctgtgtc aggaatgcca gcactacccg gcaacgcttc attttacgaa gatcgtcaac        60
     ggagaaaaaa tggaaatgca cttatgtgaa acctgtgcca aagacaaagg ggattacgtc       120
     ccggggtcga acagcttttc cattcatcag ctgttaagcg gtctgatgga tcaggacgcc       180
     tctttccctc cgaagacgga tggcagcgaa cagacccgaa ggcccgaact gcagtgtccg       240
     gagtgcggga tgacttacag acagttcggt gagggaggcc gctttggctg tgcggtctgt       300
     tacgaaacgt ttgatgataa actcgatccg gttttagcca ggattcacgg gggtaatcac       360
     agtcatacag gcaagattcc aaagcgtcag ggaaaagacc ttcacctgtt cagagaaatt       420
     gaggaacaaa aagagaagct cagaaaactg attgacgagg aagcctttga agaagcggcg       480
     gctgtcagag accggattcg tgaactcagg cagaagaccg aacagaagga ggatgagtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page