(data stored in ACNUC7421 zone)

EMBL: CP001791.PE79

CP001791.PE79        Location/Qualifiers
FT   CDS_pept        103535..104632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0082"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97631"
FT                   /db_xref="GOA:D6XV73"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV73"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADH97631.1"
FT                   /translation="MSLQSFISEAISPWMKNEGPESDIVISTRVRLARNEAHTAFPIAA
FT                   MNDRLEEVLNRVKQNFAGRSHRRFGELELLAMTDLSPNERRMLVEKHLISPNLAAGEHG
FT                   SGVLLSEDESLSVMINEEDHYRIQCLMSGFQLDACLKYANAMDDWMEEKVDFAFHENRG
FT                   YLTSCPTNVGTGLRSSVMMHLPALVLTNQFNRIVPAISQLGLVVRGIYGEGSEALGNLF
FT                   QISNQTTLGKTEADIVDNLKGVVKQLIQHERAARQTLYEQSQLFLEDRVYRSLGTLAYS
FT                   RRMETQEAMQRLSDVRLGIDLGIINHMQGKILNELMVLTQPGFLQHYAEQELSAEERDE
FT                   RRATFIRERLQLEKKNDHTNGGGQP"
     atgtctctcc aatccttcat cagtgaagcc atcagtccgt ggatgaaaaa cgaagggcct        60
     gaatcggata tcgtcatcag tacgcgtgtt cgtctcgcca gaaatgaggc acataccgcc       120
     ttccccattg ctgcgatgaa tgaccgtctt gaagaggttc tgaatcgggt gaaacagaat       180
     tttgccggaa gaagtcaccg gcgttttggg gaacttgagc tgctcgcgat gacggatctg       240
     tctcccaatg agaggcggat gctggttgag aagcatttga tcagtccgaa tcttgcggca       300
     ggcgaacacg gatcaggggt ccttctcagt gaagatgaat ccctcagtgt catgatcaat       360
     gaagaggatc attaccggat tcagtgtctg atgtcaggct ttcagcttga tgcctgcctg       420
     aagtatgcga atgcgatgga cgactggatg gaagagaaag tcgacttcgc ctttcacgag       480
     aaccgcggtt atctgacgag ctgtccgacg aatgtcggta ccggactccg ttcatcggtg       540
     atgatgcatt tgccggccct tgtgctgacg aatcagttca accggattgt ccctgcgatc       600
     agtcagcttg gacttgtcgt tcgcgggatt tacggagaag gaagcgaagc gctcgggaat       660
     ctttttcaaa tctcgaatca gacgacactc gggaaaaccg aagcggatat cgtcgataat       720
     ctcaaaggcg tcgtcaaaca gctcattcag cacgagcggg ctgcgaggca gacgctgtac       780
     gaacagtcac agctgttttt ggaagaccgg gtttaccgtt cactcgggac cctggcatac       840
     agccggcgca tggagactca ggaagccatg cagcgtctct cagacgtgcg tttaggcatc       900
     gatttaggta tcattaacca catgcagggc aagattctga atgaactgat ggtattgacg       960
     cagccgggat ttttacagca ttacgcagaa caggagctgt ccgccgagga gcgcgatgag      1020
     cgcagggcga cctttatccg tgagcggctt cagctcgaaa aaaagaatga tcataccaat      1080
     ggaggtggcc aaccatga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page