(data stored in ACNUC7421 zone)

EMBL: CP001791.PE80

CP001791.PE80        Location/Qualifiers
FT   CDS_pept        104629..107076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0083"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: CLPC; CLPC (HEAT SHOCK PROTEIN 93-V); ATP
FT                   binding / ATPase; PFAM: ATPase AAA-2 domain protein; Clp
FT                   ATPase-like; AAA ATPase central domain protein; UvrB/UvrC
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; Clp domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97632"
FT                   /db_xref="GOA:D6XV74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV74"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADH97632.1"
FT                   /translation="MMFGRFTERAQKVLSLAQEEASRLGHSNIGTEHILLGLIREGEGI
FT                   AAKALKGLGLGADKIQDEVEKLIGVGEQPAGQVHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGNSDNGNGQNGSMAGQGGQAG
FT                   ASTPTLDSLARDLTAIAKEGQVDPVIGRSKEIQRVIQILSRRTKNNPVLIGEPGVGKTA
FT                   ISEGLAQQIVDNEVPEILRNKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRNAGNVI
FT                   LFIDELHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTMDEYRKYIEKDAALERRF
FT                   QPIQVDEPTVEESVQILAGLRDRYEAHHRVTITDEAIKAAVEMSDRYISDRFLPDKAID
FT                   LIDEAGSKVRLSTYTAPPNLKEKEQELEELRKEKDASVQSQEFEKAASLRDNEQKLKDE
FT                   LETLKDEWKKKQGQEDSEVTMEDIAQVVSTWTGVPVSKLAEEETDRLLKMEDILHGRVI
FT                   GQDEAVTAVSKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAVAETLFGDEDAII
FT                   RIDMSEYMEKHNTSRLVGSPPGYVGHDEGGQLTEKVRRKPYSVILLDEIEKAHPEVFNI
FT                   LLQVLEDGFLTDSKGRRVDFRNTAVIMTSNVGAQALKQEKSLGFTANQEDAKYKDMKSK
FT                   VMEELKKSFRPEFLNRIDETIVFHSLEKSHISEIVTLMAGELQKRLKEQEIDFELSDKA
FT                   KEKIADEGFDPEYGARPLRRALQKQVEDRLSEELLRGTISKGQSVVLDVEDGEYVVRQK
FT                   ERA"
     atgatgtttg gcagatttac agaacgcgca cagaaagtac tctcacttgc ccaggaagaa        60
     gcaagccgac tcggacacag caacatcgga acggagcaca tcctgctcgg cctgatccgt       120
     gaaggcgaag gcattgcggc aaaagcactg aaaggcctcg gtctcggtgc tgataagatt       180
     caggatgaag tggaaaagct gatcggtgtc ggcgaacagc cggcaggtca ggttcactat       240
     acaccaaggg cgaagaaagt catcgaactt tccatggatg aagcccgtaa actcggccat       300
     tcctacgtag ggacagaaca catcctgctc ggtctgatcc gtgaagggga aggggtggcg       360
     gcaagggtgt tgaataacct tggcgtaagc ctgaacaaag cccgccagca ggtgcttcag       420
     cttctcggga actcggataa cggaaacgga cagaatggca gcatggcagg tcagggcggc       480
     caagccggag cgtccactcc gacgctcgac agccttgccc gggatctgac agcaatcgcc       540
     aaagaaggac aggtggatcc ggttatcggg cgttcgaaag aaatccagcg ggtcatccag       600
     attctcagcc gacgcacgaa gaacaacccg gtcctcatcg gggaaccggg cgtcgggaag       660
     acggcgattt cagaaggcct cgcccagcag atcgtcgata atgaagtgcc ggagattctc       720
     cgcaacaagc gcgtcatgac ccttgatatg ggaaccgtcg tcgcaggtac gaaataccgc       780
     ggtgaatttg aggaccgtct gaagaaggtc atggatgaaa tccgcaacgc cggaaacgtc       840
     atcctcttta tcgatgagct tcatacgctg atcggtgcag gcggtgctga aggtgccatt       900
     gatgcatcaa acatcctgaa accgtccctt gcaagaggtg agcttcagtg catcggggcg       960
     acaacgatgg acgagtaccg taaatatatc gaaaaagatg cggcccttga gcgtcgtttt      1020
     cagccgattc aggtcgatga gccgaccgtc gaagagtccg ttcagattct tgcggggctt      1080
     cgtgaccgct atgaggctca tcaccgcgtc accattacag atgaagcaat taaggcagcg      1140
     gttgaaatgt cagaccgcta tatctcagac cgcttccttc cggataaggc cattgacctg      1200
     attgacgagg ccggatccaa ggtgcgtctg agcacgtata cagcgccgcc gaatctgaaa      1260
     gaaaaagagc aggagcttga agaactccgt aaagaaaagg atgcttcggt gcaaagccag      1320
     gagttcgaaa aagcggcatc gctccgtgac aacgaacaga agctcaaaga tgagcttgaa      1380
     acgctgaagg atgaatggaa gaaaaagcag ggtcaggaag actcggaagt gacgatggaa      1440
     gacatcgcgc aggtcgtctc cacatggacc ggtgtccctg tcagtaagct tgctgaagaa      1500
     gaaacagacc gccttctgaa gatggaagac attctccacg gccgtgtcat cggtcaggac      1560
     gaagcggtga cggccgtatc aaaagcggta cgccgagcac gtgcagggct gaaagatcca      1620
     aagcgcccaa tcggttcctt tatcttctta ggaccaacag gtgtcgggaa aaccgagctt      1680
     gcaagagccg tggcagaaac actgttcggg gacgaggatg cgatcatccg tatcgacatg      1740
     tccgaataca tggagaagca caacacaagc cgtctcgtcg gttcacctcc tggctatgtc      1800
     ggtcatgatg aaggtggaca gctcaccgag aaagtccgcc gcaagccgta ttccgtgatc      1860
     ctcctcgacg agatcgagaa ggcgcacccg gaagtcttta atattctgct tcaggtactt      1920
     gaagacggct tcctgacgga ttccaaagga cgccgcgttg atttccgcaa tactgcggtg      1980
     atcatgacat ccaacgtcgg tgcccaggca ttgaagcagg aaaagagcct cgggtttacg      2040
     gcaaatcagg aagatgccaa atacaaagac atgaaatcca aggtcatgga agaattgaag      2100
     aagagcttcc gtccggagtt tttgaaccgg atcgacgaaa ccattgtatt ccattccctg      2160
     gaaaaatcgc atatttcaga gatcgtcacg ctcatggccg gcgaactgca aaagcgcctg      2220
     aaagaacagg aaattgattt tgaactgtct gataaggcga aagagaaaat cgccgacgaa      2280
     gggtttgacc ctgaatatgg tgcacgtccg cttcgccggg cgcttcagaa acaggtggaa      2340
     gaccgcctgt ctgaagaact cctgagaggc accatttcca aaggacagtc tgttgttctc      2400
     gacgtggaag acggggaata cgtcgtccgc cagaaagaac gggcgtaa                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page