(data stored in ACNUC7421 zone)

EMBL: CP001791.PE81

CP001791.PE81        Location/Qualifiers
FT   CDS_pept        107163..108575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0084"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: dal:Dalk_2956 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97633"
FT                   /db_xref="GOA:D6XV75"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV75"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADH97633.1"
FT                   /translation="MAKKKTKFICQECGYESAKWMGKCPGCSGWNTLVEEMEKPASSAH
FT                   EKRSFVTAGGGIRQKPQSIMDIEQKEENRVSTYINELNRVLGGGIVPGSLVLVGGDPGI
FT                   GKSTLLLQVSATLSEHKKKVLYISGEESLKQTKLRANRLGVGNDYLFVHSETDVEYIEQ
FT                   AIDQVNPDLVIIDSIQTVYLDHITSAPGSVSQVRESTSVFMRIAKTRGIAIFLVGHVTK
FT                   QGSIAGPRILEHMVDSVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMKETGLEEVLN
FT                   PSEIFLEERSSGASGSAVVASMEGTRPVLVEMQSLIAPTSFGNPRRMATGVDHNRISLI
FT                   MAVLEKRAGILLQNHDAYVKVAGGVRLDEPSIDLAIAISIVSSFRDQPSRAGDVIIGEV
FT                   GLTGEIRRVSRIEQRVQEAAKLGFERVIIPDRNFGGWTVPDGIEVIGARDINEAINEAL
FT                   GGRASGAPKFEL"
     atggcaaaga agaagacgaa gtttatctgt caggaatgcg gctatgaatc ggccaaatgg        60
     atggggaaat gtccgggttg ttccgggtgg aacacactcg tcgaagagat ggagaaaccc       120
     gcatcctccg cccatgaaaa acgcagcttt gtaactgcag gaggcggcat ccggcaaaag       180
     ccgcagtcga ttatggacat tgaacagaaa gaagagaacc gggtatccac atacataaac       240
     gaactgaacc gggtccttgg cggggggatc gtaccgggtt ccctcgtttt ggtaggcggg       300
     gatccgggta ttggaaaatc aacccttctc ttgcaggtat ctgcgacctt gtctgaacat       360
     aagaaaaagg tgctgtatat ctccggagaa gaatcactga aacagacaaa actgcgggcg       420
     aaccggcttg gcgtcgggaa tgactatctc tttgtacatt ccgagaccga tgtggaatac       480
     atcgaacagg ccattgatca ggtgaatccg gatctggtga tcatcgattc gattcagacc       540
     gtctacctcg atcacatcac aagcgccccg ggaagtgttt ctcaggtcag ggaatcaacg       600
     tccgtgttca tgcgtatcgc aaaaacgagg gggatcgcca tcttcctcgt tggtcacgtg       660
     acaaaacagg gctcgattgc agggccgagg atcctcgaac atatggtgga ctcggttctg       720
     tatttcgaag gggagcgtca ccacacgtac cgtatcttgc gggccgtgaa aaaccgtttc       780
     ggttcgacga acgaaatcgg gatctttgag atgaaagaga ccgggctcga agaagtgctg       840
     aatccgtcag agatctttct tgaagagcgc tcatcagggg cttcaggctc tgcggtcgtt       900
     gcatcgatgg aaggaacacg cccggtcctc gtggagatgc agtccctgat tgccccgacg       960
     agcttcggca atccgcggcg catggcgacg ggcgtggatc ataaccggat ctccctcatc      1020
     atggccgttc tcgagaagcg ggccggaatt ctgcttcaaa atcatgacgc ctatgtcaaa      1080
     gtggcaggcg gcgtgcgtct cgatgaaccg tccattgacc tggccattgc catctcgatt      1140
     gtctcgagtt ttcgggacca gccgtcaagg gccggtgacg tgatcatcgg cgaagtcggg      1200
     ctgaccggcg aaattcgccg ggtctcgcgg attgaacagc gggtgcagga agcagccaaa      1260
     ctcggctttg aacgggtcat tattcccgac cgaaacttcg gaggttggac cgtgcccgac      1320
     gggattgaag tcatcggggc tcgggacatc aacgaagcga ttaacgaagc attaggagga      1380
     cgagccagtg gagcaccgaa atttgagctt tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page