(data stored in ACNUC7421 zone)

EMBL: CP001791.PE82

CP001791.PE82        Location/Qualifiers
FT   CDS_pept        108550..109632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0085"
FT                   /product="DNA integrity scanning, DisA, linker region"
FT                   /note="PFAM: DNA integrity scanning, DisA, linker region;
FT                   protein of unknown function DUF147; KEGG: sse:Ssed_0374
FT                   ERCC4 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97634"
FT                   /db_xref="GOA:D6XV76"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV76"
FT                   /inference="protein motif:PFAM:PF10635"
FT                   /protein_id="ADH97634.1"
FT                   /translation="MEHRNLSFDDSLTRRILTFVAPGTPLREGIDNVLRANTGGLIVVG
FT                   FNEEMQKIVNGGFYINTDFSPAYLYELAKMDGAIILNEDATRILYANTQLVPENLIEST
FT                   ETGIRHRTAQRVAKQAGNLVISISQRRHVITLYQGRYRYSLKDIGVILTKANQAIQTLE
FT                   KYKSVLDQSITNLGALEFEELVTFQEVSQVMHRIEMVLRIKSELMNYVIELGDEGRLIS
FT                   MQLEELVLNIEQIALDLIMDYQKDSGTPPEDVLENLKRLSSDELLDDQIIVKLFGYGKI
FT                   VNLSDFPVSPRGYRILRKIPRIPPKVIRNLVRQFGTLSEMIRADIQELDEVEGIGEARA
FT                   NKIQDGLSRIQEQLIIDRHI"
     gtggagcacc gaaatttgag ctttgatgac agtttaacaa gacgtattct gacatttgtt        60
     gccccgggga ccccgctgag ggaagggatc gacaacgtgc tgcgggccaa cacgggcggg       120
     ctgattgtcg tcggattcaa tgaagaaatg caaaagatcg tcaacggggg cttttacatt       180
     aatacggact tctcgccggc ctatctgtat gaactcgcaa agatggacgg ggcgattatt       240
     ttgaacgaag atgccacgcg aattctgtat gccaataccc agctcgttcc ggagaacctg       300
     attgaatcga cggagacagg gattcgtcac cggacagcac aacgcgtggc caagcaggcg       360
     ggcaatcttg ttatttccat ctcacaacgc cgtcacgtca ttaccctgta ccagggccga       420
     taccgctatt cgctgaagga tatcggggtg atcttaacga aagcgaatca ggcgattcag       480
     accctcgaga agtacaaatc ggtccttgat cagtcgatca cgaacctcgg tgccctggag       540
     tttgaggagc tcgtgacctt tcaggaagta tcccaggtga tgcaccggat tgaaatggtg       600
     ctcagaatca aaagtgagct gatgaactat gtcattgagc tcggtgacga aggccggctc       660
     atatccatgc agcttgagga actggtcctg aatatcgaac agattgccct cgatctgatt       720
     atggattatc aaaaggacag cggcacaccg ccggaagacg tgcttgagaa cttaaaacgg       780
     ctctccagtg acgaacttct cgacgatcag atcatcgtca aattgttcgg ttacggcaaa       840
     atcgtgaatc tgtccgattt cccggtttca ccaaggggct accggatcct ccgtaaaatt       900
     ccgcggatcc cgccgaaggt gatccgtaac cttgtccgcc agttcggcac gctgtcagag       960
     atgatccgtg cagatattca agagcttgac gaggtggaag ggatcggaga ggcgcgggca      1020
     aacaagattc aggatggact gagccggatt caggaacagc tgatcatcga ccgtcatatt      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page