(data stored in ACNUC7421 zone)

EMBL: CP001791.PE85

CP001791.PE85        Location/Qualifiers
FT   CDS_pept        111622..112119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0088"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; KEGG: ppd:Ppro_0012 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97637"
FT                   /db_xref="GOA:D6XV79"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV79"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADH97637.1"
FT                   /translation="MRIGQGFDVHQLKEGRPLILGGIEIPHEQGLDGHSDADVLLHTIA
FT                   DACLGAVAEGDIGKHFPDTDPAFKDADSAKLLEHVWQIVKEKGYTLGNLDCTIMAQRPK
FT                   MAPHIDAMRTRIAGLLEADVSQINVKATTTEKLGFTGREEGIASQAVVLLVEQPTAFTS
FT                   VP"
     atgcgaattg gacaaggatt tgatgtgcat cagttaaaag agggacgtcc gctgattctc        60
     ggcggcattg agattcccca tgaacaggga ttagacggcc attccgatgc ggatgtcctg       120
     ttacatacga ttgccgacgc gtgcctcggt gccgtggcag aaggggacat cggcaagcat       180
     tttcccgata cggacccggc ttttaaggat gccgactcgg cgaaactcct tgagcatgtg       240
     tggcagatcg taaaggaaaa gggctatacg ctcggaaatc tcgattgcac aattatggca       300
     cagcggccca agatggcccc gcatattgac gcgatgcgca cccgtattgc cggactcctc       360
     gaagccgatg tttcacaaat caacgtcaaa gcgacgacga cggaaaaact cggattcacc       420
     ggaagagagg aaggcatagc ctcgcaggct gtggtattat tggtggagca gccaacggct       480
     tttacatcgg ttccgtaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page