(data stored in ACNUC7421 zone)

EMBL: CP001791.PE87

CP001791.PE87        Location/Qualifiers
FT   CDS_pept        113728..114684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0090"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: glo:Glov_2614 serine O-acetyltransferase;
FT                   TIGRFAM: serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97639"
FT                   /db_xref="GOA:D6XV81"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV81"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADH97639.1"
FT                   /translation="MRLLRASPDPPLNAPWSTRTKAAQAVDLRRQGAVMIPVKVKDSGQ
FT                   AAVVRILKQSGTARKRLCVPIRAQRRFFYPDHQEEHPSRIDRHEGGPPVKQAFKTLKND
FT                   VDIVLDQDPAARNRFEVIMTYSGVHAIWNHRIAHALWNRKFFFLARVISQISRFFTGIE
FT                   IHPGAQIGQHLFIDHGMGVVIGETCEIGDNVTIFQGVTLGGTGKEKGKRHPTIEDHVLI
FT                   ATGAKVLGSMTIGAHSRIGAGSVVLKEVPPHATVVGIPGKVVMKNGVKVADSHDHHKLP
FT                   DPIADKFDSLEQELKELREEVARLKKQGGQDRDHTAL"
     atgcggttgc tgcgagcatc tcctgatcca ccgctgaatg caccctggag cacccggacc        60
     aaagcagctc aggctgtcga cctccggcgg cagggagccg ttatgatccc ggtaaaagtg       120
     aaggattccg gacaggcagc tgtcgtccgt atccttaaac agagtggaac cgcgcgcaag       180
     cgtctctgtg tcccgatcag ggcacagaga cgcttttttt atcctgacca tcaggaagaa       240
     cacccatcac gaatagacag gcacgaagga ggcccacccg tgaaacaagc attcaaaaca       300
     ctgaaaaacg atgtagatat cgttctcgac caggaccctg ccgcaaggaa ccgttttgaa       360
     gtcatcatga cctattcagg cgtgcatgcc atctggaacc accggatcgc ccacgctctc       420
     tggaaccgga aattcttttt cctggcgagg gtcatctctc agataagccg ttttttcacc       480
     gggatcgaga tccaccccgg cgcgcagatc ggccagcatc tgttcatcga ccacggcatg       540
     ggcgtcgtca ttggtgagac gtgcgagatc ggcgacaacg tcacgatctt tcagggcgtg       600
     acccttggcg gtacggggaa ggaaaaaggc aaacgccacc cgacgattga ggatcacgtc       660
     ctgatcgcca caggtgccaa ggtgctcggc tcgatgacga tcggtgccca ttcacggatt       720
     ggtgcagggt ccgtcgtctt aaaggaagtg ccgccgcacg ccaccgttgt cgggattccg       780
     ggaaaggtcg tcatgaagaa cggagtcaag gtcgccgact cgcatgacca ccacaagctc       840
     cctgacccga tcgctgacaa atttgattca cttgaacagg aactgaaaga actgcgggaa       900
     gaagtggccc gccttaaaaa acaaggagga caggaccgtg accatacagc tttataa          957
//

If you have problems or comments...

PBIL Back to PBIL home page