(data stored in ACNUC7421 zone)

EMBL: CP001791.PE88

CP001791.PE88        Location/Qualifiers
FT   CDS_pept        114665..116068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0091"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   gme:Gmet_0057 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia; Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97640"
FT                   /db_xref="GOA:D6XV82"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV82"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADH97640.1"
FT                   /translation="MTIQLYNTLTRQKETFQPIEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   VVFDMVRRYLEYRGYDVTYVSNFTDVDDKIIKAANELDEDVMTVAERYIAAYYNDTEAL
FT                   GVRKADLHPRVTESMDDIITFITRLIDKGYAYESSGDVYFRTRKFDTYGQLSQQSLDDL
FT                   QAGARIQVEEKKEDPLDFVLWKTAKEGEIAWSSPWGEGRPGWHIECSAMVKKHLGDTID
FT                   IHAGGQDLSFPHHENEIAQSEALNEQRMANYWIHNGYINIDNEKMSKSLNNFILVHDII
FT                   RQFDPDVVRFFIVNAHYRSPINFSDEQLETAKTSLERIQTTYENLTYRLGESADLGGGQ
FT                   DKWFALIRKEGERFIASMDDDFNSANAVAVMFDLVRQANIYLTEKHTSKEVLEAFLKQF
FT                   DDMAFVLGIAVKRQAELLDEDVEQLIEERIQARKDRDFARADEIRDSLKDQGIILEDTP
FT                   QGTRWKRGS"
     gtgaccatac agctttataa cacgctgaca cgacaaaaag aaacgtttca accgatcgaa        60
     gaaggaaagg tcaagatgta tgtctgcggc ccgaccgtct acaactatat tcatatcggc       120
     aatgcccgtc cggccgttgt cttcgatatg gtgcgccgct acctcgaata ccggggctat       180
     gatgtgacgt atgtctcgaa tttcacggat gtggatgaca aaatcatcaa agccgcaaac       240
     gagctcgacg aagacgtcat gaccgttgcc gagcgataca tcgccgctta ttacaacgac       300
     accgaagccc tcggcgtcag aaaagcggac ctgcacccga gggtgaccga gtccatggat       360
     gatatcatca cgtttattac ccgcctcatc gacaaaggct acgcctacga atcgtccggg       420
     gatgtgtact tccgtacgag aaagtttgac acttacggtc agctttccca acagtccctc       480
     gatgatctcc aggccggtgc gaggatccag gtcgaagaga agaaagaaga tcccctcgac       540
     ttcgtgctct ggaaaacggc gaaggaaggg gagatcgcat ggtcaagtcc gtggggagaa       600
     ggacgcccgg gctggcatat tgaatgctcc gccatggtca aaaaacacct cggcgacacg       660
     attgacattc atgccggggg gcaagacctg tcttttccgc atcatgaaaa tgaaatcgcc       720
     cagtccgagg cactgaatga acagcggatg gcgaattact ggattcataa cggctacatc       780
     aatatcgaca acgaaaagat gtccaagtca ctgaacaact tcattctcgt tcacgacatc       840
     atccgtcagt tcgacccgga tgtggtccgg ttcttcatcg tgaacgcaca ctaccggagc       900
     ccgatcaact tcagcgatga gcagcttgag acggcaaaga cgagtcttga gcgcatccag       960
     acgacctatg agaacctcac gtaccgtctc ggtgaaagtg cggatctcgg cgggggtcag      1020
     gacaagtggt ttgccctcat caggaaagaa ggcgagcggt tcatcgcttc gatggacgat      1080
     gacttcaaca gcgccaacgc agtggcggtc atgtttgatc tcgtcagaca ggcaaacatt      1140
     tacctgacgg aaaagcatac ttcaaaagaa gtccttgaag cctttctcaa gcagtttgat      1200
     gacatggcat tcgttcttgg cattgccgta aagcggcagg cggagctgtt ggacgaagat      1260
     gtggaacagc tcattgaaga gcggatccag gcgaggaaag accgggattt tgcccgggcg      1320
     gatgagattc gtgattcact gaaagatcag gggattatcc tcgaagacac gccgcagggc      1380
     acgcgctgga agcggggttc atag                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page