(data stored in ACNUC7421 zone)

EMBL: CP001791.PE9

CP001791.PE9         Location/Qualifiers
FT   CDS_pept        complement(16705..17337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97561"
FT                   /db_xref="GOA:D6XV03"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97561.1"
FT                   /translation="MTIDDYLHEFQSRLTYVSEKEQTKIKYDIRSEIEQIKENLLEHEE
FT                   LDEEEAEHQAVASYLSPADMAQEINDQYFESIDEQFSGRSIAFIFVLSVILTPLGILII
FT                   PFVTGSFNGFSDQLIPRLVFMLIAALILFFYYPKHITSEQLRSLRQIFVVLYWYPVILV
FT                   FAFVLNLFRSDGFSMNLTLYLAVSLFIWLLILFGTRIFYQKQLNKPL"
     gtgaccatcg atgactacct gcatgaattc caaagcagac tgacgtacgt aagtgaaaag        60
     gaacaaacga aaatcaaata tgatatccgc agcgagattg agcagattaa agagaatctt       120
     cttgaacatg aagagcttga tgaggaagaa gctgaacatc aggctgtggc ctcctatctg       180
     tcaccggctg atatggcaca agaaatcaat gaccagtatt tcgaaagcat tgacgaacag       240
     tttagcggtc gttcaatagc gtttattttt gttttatccg tcatccttac accgcttggt       300
     atattgatta ttccatttgt gaccggatcc tttaacggct tttcagatca actgattccc       360
     cgattggtct ttatgcttat cgccgctttg atcctgtttt tctattatcc aaagcatatc       420
     acttcagaac agctgcgatc actgcgacaa atctttgttg tattatactg gtaccctgtt       480
     attttggtgt ttgccttcgt attgaatctt ttccgttcag acggcttctc catgaatctc       540
     accctttacc tcgcagtaag tctgttcatc tggctgttaa tcctcttcgg aacccggatc       600
     ttttaccaaa aacagctgaa caaaccgttg taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page