(data stored in ACNUC7421 zone)

EMBL: CP001791.PE91

CP001791.PE91        Location/Qualifiers
FT   CDS_pept        117250..117759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0094"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   hypothetical protein; K06962"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97643"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV85"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADH97643.1"
FT                   /translation="MRNILLVDGYNIIGDWVELRDLQKTDLEGARDQLIEKMAEYQAYT
FT                   GTEVIIVFDAHMVPGLGKSYRNFSVEILYTREKETADERIEKLVTELKRVDTKIYVATS
FT                   DFVEQRVIFASGAYRKSARELRTEVSQLEKKIASDVSRTKATKLRGGIPINDEVKKMFE
FT                   RMRRGK"
     atgcgtaata tcctcctcgt cgacggctac aacatcatcg gagactgggt tgagcttcgg        60
     gatttgcaaa agacggatct cgaaggagcg cgggatcagc tgattgagaa aatggccgaa       120
     taccaggctt acaccggcac cgaagtcatc atcgtctttg atgcccatat ggtccctggg       180
     cttggcaaga gctaccggaa cttctccgtg gagattctgt acacccgtga aaaagagacg       240
     gctgatgaac gcatcgaaaa gctcgtcacc gaactgaaac gggtggatac gaaaatctat       300
     gtggccacga gtgattttgt cgagcaacgg gtgatctttg cgagcggtgc ctaccggaaa       360
     tcagcccgtg agttgcgaac cgaggtctct cagctcgaaa agaaaatcgc cagtgatgtc       420
     agccggacga aagcgacgaa gctgcgcggc gggatcccca tcaatgatga agtcaagaag       480
     atgtttgaga gaatgcgaag aggaaaataa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page