(data stored in ACNUC7421 zone)

EMBL: CP001791.PE92

CP001791.PE92        Location/Qualifiers
FT   CDS_pept        117987..118631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0095"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: hip:CGSHiEE_09090 RNA polymerase sigma factor
FT                   RpoE; TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97644"
FT                   /db_xref="GOA:D6XV86"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV86"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ADH97644.1"
FT                   /translation="MNRNLQQSMHQLTDEEVVEYVREGDSQALEYLIEKYRNFVRAKSR
FT                   SYFLIGADHEDILQEGMIGLYKAIRDFKQGKESSFRAFAELCITRQIITAIKTATRQKH
FT                   IPLNSYVSLDKPIYEEDSDRTLLDVIMSSEELDPEEMFISQEDAARIEGTMNNVLSDLE
FT                   QKALMLYLEGSSYQEISEELNRHVKSIDNALQRVKRKLENHKDFKSAELFD"
     gtgaacagga atctgcagca atccatgcat cagcttacgg atgaagaggt tgtcgaatac        60
     gtcagggaag gcgattccca ggcgctggag tatttgattg agaaataccg gaactttgtg       120
     cgggccaaat cccgctcgta ttttctgatc ggagcggatc atgaggatat tcttcaggaa       180
     gggatgatcg gtctctacaa agcgattcgt gacttcaagc aggggaagga atcttcgttc       240
     cgggcttttg ctgagctttg cattacgaga cagatcatca ccgccatcaa gacagccacc       300
     cgtcagaagc atattccgct gaactcctac gtctctctcg ataaaccgat ctacgaggaa       360
     gactcggacc ggaccctcct cgacgtgatt atgagttccg aggagcttga cccggaagag       420
     atgttcatca gccaggaaga tgcggcgcgg attgagggga cgatgaacaa cgtcctgtcc       480
     gatctcgaac agaaggcgct gatgctgtat cttgaaggaa gcagctatca ggagatctcc       540
     gaagagctga accggcacgt caagtccatc gacaatgccc tgcagagggt caagagaaag       600
     cttgagaacc acaaagattt caaaagtgca gaactatttg attaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page