(data stored in ACNUC7421 zone)

EMBL: CP001791.PE93

CP001791.PE93        Location/Qualifiers
FT   CDS_pept        118777..119331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0096"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: pfo:Pfl01_0184 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
FT                   type 2; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97645"
FT                   /db_xref="GOA:D6XV87"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV87"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97645.1"
FT                   /translation="MDEELVKDALKGDERAFETLHARHADDVFRYVYMKVGNRQDAEEL
FT                   LQDVFVKMVRNLAGFSGKSTFRTWLFSIVRHTVIDYYRKKGRLQKEQPVENDLLEAVSD
FT                   TTASAEEVASNREKRSHVSDAFNSLPEGHREILYLRFMEGFSLKETARITGKSVMAVKS
FT                   LQKRAQAKMGEQVDEEVNIHV"
     gtggacgaag aactggtcaa agatgcgctc aaaggcgatg aacgggcctt tgagacgctt        60
     cacgcgaggc atgcggatga tgtgttccgc tatgtataca tgaaagtcgg caacaggcag       120
     gacgcggaag aactcttgca ggatgtattc gtaaagatgg ttcgcaacct ggccgggttt       180
     tccggcaaat caacctttcg gacctggctg ttttcgattg tcaggcatac ggtgattgac       240
     tattaccgca agaagggtcg cctgcaaaag gaacagccgg tggagaatga cttactggag       300
     gccgtgtcgg atacgacagc atccgctgaa gaggtggcat caaaccggga aaaacgcagt       360
     cacgtatctg atgcctttaa cagcctaccg gaagggcaca gggagatttt gtacttacgg       420
     tttatggagg gattttccct gaaagagacg gcacggatta cgggcaagag tgtgatggcc       480
     gttaagtccc tgcaaaaacg ggcgcaggcg aaaatgggcg agcaagtgga tgaggaggtg       540
     aacatccatg tctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page