(data stored in ACNUC7421 zone)

EMBL: CP001791.PE94

CP001791.PE94        Location/Qualifiers
FT   CDS_pept        119324..120853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97646"
FT                   /db_xref="GOA:D6XV88"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97646.1"
FT                   /translation="MSENRINEQLKQEKDAIGEVSPSQEAKEKSLRAMKNEIHAQDNIL
FT                   QSMAKKKRRNQMLTGFTATVAAAAIGGLVLISSDDMAGWFNPAGTVDDGDHNENEEEAP
FT                   EPLDTNENEEEEEDERDEEDVETEEEQPSDVTADTFNDRTQRFYNIDLRAVDADDQEDV
FT                   IEEQSMRLLYEDGMPYSVYIPADWTLTTAEGQSYTRYEMADDHGTVFHLLQFETGDEAA
FT                   ARSELNRQLDDRDAEAVSEDEQWLQDFHWTMEMGDEPVEQYRAEDGDRVHNWSFVNPEG
FT                   YPDTPVILHSVETVENDDQIERAGYFHSSFQRVYPTVIDESDETGMNDRALEAEILSMS
FT                   DHGPGTRETVLNEAADLGVSFYYRERFSDSETGDRGQRMIRNESENDLSFVELGRFDTV
FT                   DEALAYQQDWRETGNGLPEQGEEPEMHLGNRYSGDWLVNRDVLGISGEVREELETEGGL
FT                   SAFNDEEMFFVFERNGYGYYMMTGGDIYFSEYIDLILHTWQWEDGTMLLDE"
     atgtctgaaa accggatcaa tgaacagctc aaacaggaga aagacgcaat cggcgaggta        60
     tcaccgtcgc aggaggcgaa ggagaaaagc ttgcgtgcga tgaagaacga gatccatgca       120
     caggacaaca tacttcaaag catggcgaag aagaaaagac gcaatcagat gctcaccggc       180
     tttacggcca cggtcgctgc cgcggcaatc gggggcctgg ttctgatcag ttctgatgat       240
     atggccgggt ggttcaaccc tgccggaaca gtggatgacg gggatcataa tgaaaacgaa       300
     gaggaagcac cggagcctct tgatacgaac gaaaacgaag aagaagagga agatgaacgt       360
     gatgaagaag acgtggaaac ggaggaggaa cagccttcgg atgtgacggc agacacgttt       420
     aacgaccgca cccaacgctt ttacaatatt gacttgcgcg ccgtggatgc cgatgaccaa       480
     gaggacgtca ttgaagagca gtcaatgagg ctcctgtatg aggacggtat gccgtattcg       540
     gtttatatac ctgcggactg gacgctgaca acagctgaag gccagtcata tacccgttat       600
     gaaatggcgg atgatcatgg gacggtcttt catctcctgc aatttgaaac gggggatgaa       660
     gctgcggccc gctctgaact caacagacag ctggatgacc gtgatgcaga agcggtgtcc       720
     gaagacgagc agtggctgca agattttcac tggactatgg aaatgggtga tgagccggtg       780
     gagcaatacc gcgcggaaga cggggatcgt gtccataact ggtcgtttgt gaatcctgag       840
     ggatacccgg atacgccggt cattctgcat tccgttgaaa cggtggagaa cgatgaccag       900
     atagagcgtg caggttattt tcactcgagt tttcaacggg tctatccgac ggtcattgat       960
     gaaagtgatg aaacagggat gaatgaccgg gccctcgaag cagagatttt atccatgagt      1020
     gatcacgggc cgggtacaag agagaccgta ttgaacgagg cggcggacct tggtgtttcc      1080
     ttttattaca gggaaagatt cagtgactcc gagacggggg accgtggaca acgaatgatc      1140
     cgcaatgaga gcgaaaatga tttatccttt gtggaacttg gtcgctttga tacagtcgat      1200
     gaggccctcg cctaccaaca ggactggcgg gagaccggga acgggctccc ggagcagggg      1260
     gaagaacctg agatgcacct ggggaaccgt tacagcggag actggctcgt aaaccgggac      1320
     gtacttggta tttctggcga agtgcgggag gagctcgaaa cagaaggcgg tctttcggcg      1380
     tttaacgatg aggagatgtt cttcgttttc gagcgtaacg gctacggcta ttacatgatg      1440
     acaggagggg atatctactt ttcggaatac attgacctga tcctccacac ttggcagtgg      1500
     gaagacggga ctatgcttct tgacgagtaa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page