(data stored in ACNUC7421 zone)

EMBL: CP001791.PE98

CP001791.PE98        Location/Qualifiers
FT   CDS_pept        122120..122587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0101"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: ribosomal
FT                   protein L11; KEGG: gur:Gura_1057 50S ribosomal protein L11;
FT                   SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97650"
FT                   /db_xref="GOA:D6XV92"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV92"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADH97650.1"
FT                   /translation="MLGLPHHGLKEVCRVAKKVIKVVKLQIPAGKANPAPPVGPALGQA
FT                   GVNIMGFCKEFNARTQEDAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIDSGSG
FT                   EPNKNKVATIKRDKVKEIAETKMPDLNAADVEAAMRMVEGTARSMGIVVED"
     atgctcggtt taccacatca cggacttaag gaggtgtgtc gcgtggctaa aaaggtcatt        60
     aaagtagtga aacttcaaat tcctgcaggc aaagcgaatc cggcaccacc ggtcggaccg       120
     gcactcggtc aagctggtgt taatatcatg ggattctgta aggaatttaa tgctcgtacg       180
     caagaagatg cgggcctgat cattcctgtt gaaatcacag tgtttgaaga ccgttcattc       240
     acttttatca cgaaaactcc accagcagcg gttctgctta aaaaagcagc cggaatcgac       300
     tctggttcag gagagccaaa caagaacaaa gtggctacaa tcaagcgtga taaagttaaa       360
     gaaatcgctg aaacaaagat gcctgacctg aacgcagcag atgtagaagc tgctatgcgt       420
     atggttgaag gtactgcccg cagcatgggt attgtcgtag aagactaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page