(data stored in ACNUC7421 zone)

EMBL: CP001791.PE99

CP001791.PE99        Location/Qualifiers
FT   CDS_pept        122704..123399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0102"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: gur:Gura_1058 50S ribosomal protein L1;
FT                   TIGRFAM: ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97651"
FT                   /db_xref="GOA:D6XVM8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVM8"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADH97651.1"
FT                   /translation="MAKKGKKYQDALKQIDREKLYNISEAVELVQKNATSKFDETIEMA
FT                   ARLGVDPKKADQQIRGAMVLPHGTGKTQTVLVFAKGDKAKEAEAAGADFVGEDDLINKV
FT                   AQGWMDFDVVVATPDMMAQVGKLGRTLGPKGLMPNPKTGTVTFDVTKAVEEIKAGKVEY
FT                   RVDKSGNIHVPLGKASFDQQKLEENFTAMVDQLVKIKPAASKGTYLRNVSITSTMGPGL
FT                   KVDVSGFKL"
     ttggctaaaa aaggtaaaaa gtatcaagat gcgctgaagc aaattgatcg cgaaaaacta        60
     tacaatatct ctgaagcagt tgaactggtt cagaagaacg caacgtccaa gttcgacgaa       120
     acaatcgaaa tggctgcacg tctcggcgtt gacccgaaga aagcagacca gcagatccgt       180
     ggagcgatgg tgcttccgca cggaacaggt aagacacaga ctgttctcgt atttgcaaaa       240
     ggtgacaagg cgaaagaagc cgaagctgca ggcgcagact tcgttggtga agatgatctc       300
     atcaacaagg tagcgcaagg ctggatggac ttcgacgttg tcgttgccac accggacatg       360
     atggcacagg ttggtaagct gggtcgtacc ctcggaccaa aaggcctcat gccgaacccg       420
     aagacaggca ctgttacgtt tgacgtgaca aaagccgtcg aggaaatcaa agcaggtaaa       480
     gtggaatacc gtgtcgacaa gtccggtaac atccacgtgc cactcggcaa agcctctttc       540
     gatcagcaga agctcgaaga gaacttcact gcaatggttg atcagctcgt aaagatcaag       600
     ccggcagcat caaaaggtac gtatctccgt aacgtatcca tcacgtccac aatgggccct       660
     ggtctgaaag tggatgtatc cggctttaaa ttataa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page