(data stored in ACNUC7421 zone)

EMBL: CP001825.PE1

CP001825.PE1         Location/Qualifiers
FT   CDS_pept        85..1455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bar:GBAA0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40925"
FT                   /db_xref="GOA:D1CDB9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDB9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACZ40925.1"
FT                   /translation="MNPKQVWQAVLGELEVRLNPAQFETWIKNTSLVSLDEDEAVISVP
FT                   TSFAQMTIERKFEPEIRRSLSNILHRPVQVSFVVNGIISSNERSSRSNESSVEAPLLNA
FT                   AQNTSTQFGAPNTPLNPRYTFENFIVGSSNRMAHAACMAVAEHPAEAYNPLFLYGGVGL
FT                   GKTHLLHAIGNHALKLKPYLRVLYVSSEQFTNDLINAIREHRTEEFRARYRSIDILLID
FT                   DIQFIAGKESTQEEFFHTFNHLHGANKQIVMTSDRPPKAIATLQDRLRSRFEGGLMTEV
FT                   NLPDLETRIAILRIKAENKGVDLPDDVLELIARKVQSNIRELEGALNSIVALARLTGEP
FT                   ITLATAAEALNDTTMARKKRQITPERILQAVASYYGVDEKLLKGKTRAREVVIPRQVAM
FT                   YIMREDTDQSLSEIGAILGGRDHTTVLHGITKVEKDIEVDTKLRQDVMTVREMLYNN"
     atgaacccga aacaggtctg gcaagccgta cttggagaac ttgaggtcag actcaatcct        60
     gcacagtttg agacctggat caaaaacact tctctcgtgt cgctggatga ggatgaagct       120
     gttatatccg tccccacaag cttcgcccag atgactatag agaggaaatt cgagcctgag       180
     ataagaagat ctctgagcaa catattacat agacctgtgc aggttagttt cgtagtaaat       240
     ggcataattt cctcaaatga gcgtagctcc agaagcaatg agagctctgt ggaagccccc       300
     ttactgaacg ctgcgcaaaa cacaagcacc cagtttggcg cgcctaacac gccactcaat       360
     ccccgctata ccttcgagaa cttcatcgtt ggtagcagta acagaatggc tcatgctgca       420
     tgcatggcag tagctgaaca cccagctgaa gcctataatc ctttgtttct atatggaggc       480
     gtagggctgg gtaaaactca cctgctgcac gcaattggta accatgctct gaagctgaaa       540
     ccatacctgc gggtgctata cgtgagcagt gagcagttta ccaatgatct gattaacgcc       600
     attagagaac atagaacaga ggagttcagg gctcgttata ggagcatcga tatccttctg       660
     atcgatgata ttcagtttat agcaggcaag gaaagcaccc aggaggagtt cttccacacc       720
     tttaatcacc ttcatggggc aaataagcag atcgtgatga cgagcgatcg accacccaag       780
     gctatagcga ccctacagga taggctaagg tccagattcg aaggcggcct catgactgag       840
     gttaacctgc cggacttgga gaccagaatc gcaatactcc gtataaaggc cgagaacaag       900
     ggtgtagacc ttcctgatga tgtgcttgag ctaatagctc gcaaagtgca gagcaatata       960
     cgagagctgg aaggagcact gaacagcatt gtggcgttag ctagacttac gggagaacct      1020
     ataaccctgg cgaccgctgc agaagcactc aatgacacca ctatggccag gaagaagaga      1080
     cagatcactc ctgagcgtat cctacaagct gtggcatcct actacggcgt agatgaaaag      1140
     ctgctgaagg ggaagacgag agcaagagag gttgtaatac ctagacaggt agcgatgtac      1200
     atcatgagag aggatactga tcagtccctt tcagagattg gagccatcct aggtggtaga      1260
     gaccatacaa ctgtacttca tggtataacg aaggtagaga aagatataga agtagacacc      1320
     aagctccgac aagatgtcat gacagtaaga gagatgctct ataacaacta g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page