(data stored in ACNUC7421 zone)

EMBL: CP001825.PE10

CP001825.PE10        Location/Qualifiers
FT   CDS_pept        10710..11282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0010"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   aba:Acid345_1412 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40934"
FT                   /db_xref="GOA:D1CDC8"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC8"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACZ40934.1"
FT                   /translation="MNRQEAWELLNEYVKSPNLIRHCLAVEAAVRGYARLYGEDEELWG
FT                   LAGLLHDFDYEIHPTLDQHPSMGKPILEARGVPQEVIYAIQSHSDFTGVPRVHLLDKVL
FT                   YASDEISGFIVAVALVKPSRSIHEVDVKSVKKKLKDKAFARNVNRDDIYRGAEELGVDL
FT                   DTHIANVIEFLKPISDELTPKEQNVSR"
     gtgaacagac aagaggcatg ggaactgttg aatgagtacg taaaatctcc gaatcttata        60
     aggcattgct tggctgtgga agcagcagta agaggctacg ctcgtctgta tggcgaagac       120
     gaagagttat ggggattggc agggttgcta catgacttcg actacgaaat acatcctacg       180
     cttgaccagc acccatcgat gggcaagcca atactcgaag ccagaggcgt gcctcaggaa       240
     gttatatatg ccattcaaag ccactccgac ttcacgggag tacctcgagt acacctatta       300
     gataaagtac tctatgcttc tgatgagatc tcaggcttca tagtagctgt agcactcgtt       360
     aagccctccc gcagcatcca cgaggtagac gtcaaatcgg tcaaaaagaa gttgaaggac       420
     aaggctttcg cacgcaatgt gaaccgagat gacatatata gaggagctga agagctggga       480
     gtagacctag acactcatat tgctaacgtc attgaattcc tgaaacccat ctcagatgag       540
     cttactccaa aggaacaaaa tgtctctcgc tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page