(data stored in ACNUC7421 zone)

EMBL: CP001825.PE102

CP001825.PE102       Location/Qualifiers
FT   CDS_pept        115384..116151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0104"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ppd:Ppro_2693 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41026"
FT                   /db_xref="GOA:D1CDM0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ41026.1"
FT                   /translation="MTEGRPFISVIIPAYNEAKRLPVTIPRIVSFLSSQGWQYELIVVD
FT                   DGSTDETQQIACQLSKEYPSIRLLKLPHRGKGPAVREGVLASTGDLVLFTDADLSTPIS
FT                   QLSKLLARIEQGYDIAIGSREGVGARRYKEPFYRHLMGRVFNLFVRLLTLAHFNDTQCG
FT                   FKLFRKHAAKDIFSNLVLYGSTAPAIKGPMVTSLDVEVLQIAARRGYKVAEVPVEWHYS
FT                   SGSKVRPALDSYRMLKDIIRIKLNDLRGMYDKK"
     ttgacagaag gtcgaccttt catctctgtg attatccctg cttacaatga ggccaaacgc        60
     ctgccagtta cgatccctag gatcgttagc ttcctcagct cgcagggatg gcaatacgag       120
     ttaatagttg tcgatgacgg gagcacagac gaaacgcaac agatagcttg ccagttgagt       180
     aaagaatacc catccattag gctgcttaag ctgccacata gaggtaaagg tcctgcggtg       240
     agggaaggcg tgctagcgag cacgggtgat ctagtactat ttacggacgc tgacctctct       300
     actccaatct ctcaactcag caaattactt gcacgcatag agcaaggata cgacatagct       360
     attgggagca gagaaggagt gggagctaga aggtataagg aacccttcta tcgacaccta       420
     atggggagag tattcaacct gtttgtcagg ttactaacat tggcgcactt caatgacact       480
     caatgtggtt tcaagctctt caggaaacat gcagctaagg acattttttc aaacctagtg       540
     ctttacggta gcacagcccc ggccatcaag ggtcctatgg ttacaagtct ggatgtagaa       600
     gtgcttcaga tagcagccag gaggggttat aaagttgctg aagtgccggt cgaatggcac       660
     tatagttccg gtagcaaagt cagacctgct ttggattcat atagaatgct taaggatata       720
     atccggataa agctcaacga tctacgggga atgtacgaca agaagtag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page